SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|387790619|ref|YP_006255684.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387790619|ref|YP_006255684.1|
Domain Number 1 Region: 63-104,183-292,648-712
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.13e-24
Family Prokaryotic proteases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387790619|ref|YP_006255684.1|
Sequence length 724
Comment Peptidase S46 [Solitalea canadensis DSM 3403]
Sequence
MKKYLLSIPLGVSLVISSAFTPPVSVNPPDEGMYPLSEIKKLDLKKAGLKINQSDIYNPN
GLSLIDALVQISGCSGSFVSNEGLIITNHHCAFSAVQLASTPEHNYLENGFVAKTREQEI
EAKGLTVRITDSYEDVSTKILNAAAATNDPAERIRIIQNKSTELEREAEAQDKTIKAQVS
EMFMGKSYVLFKYKTIKDIRLVYIPQRSVGEFGGETDNWVWPRHTGDFSFVRAYVGKDGS
SAAYSKDNVPYKPKKFLKVNPKGVNENDFVFILGYPGRTFRHRPAQYLEYQEKYLLPYIS
DLYTFENQSMEEASTGNVGLQLKQATRIKRNANRLKNYQGKLQGLRSIGLVEQKRAEDDD
MQKFINGDPKLSQQYGSLLQNIDNLYKDVFADAQRDLWLSELYSSTNLLGIANALSILKK
QTEAAPNKTLYFQQNKERFKKVVDGLYDSFVLESDKKIFNRMMLDGFKLPQEQRVDAVQR
LLLMDTGIETSAKEATNHILTTSLKDSEFTAKLLNSSTEKELLAFDEPIMSFVNQVNEQT
AVLDPIKQKREGTLNKLMGDYVTVKELYKKKDFIPDANSTLRLTYGYVRGYTPVDATYYS
PFTGIKGIIEKGATGNPEFKYPDVIRELYQKKDFGMFKNPKADDVPVALLYNMDTTGGNS
GSPIMDANGNLIGVNFDRAYSATINDFAWNESYSRSIGVDIRYVLWVAQKVDKADFILTE
LGVK
Download sequence
Identical sequences H8KVK5
WP_014679735.1.74489 gi|387790619|ref|YP_006255684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]