SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226227763|ref|YP_002761869.1| from Gemmatimonas aurantiaca T-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226227763|ref|YP_002761869.1|
Domain Number 1 Region: 40-343
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.48e-64
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 349-546
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.1e-44
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00099
Further Details:      
 
Domain Number 3 Region: 594-854
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.82e-42
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0016
Further Details:      
 
Domain Number 4 Region: 891-1072
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.94e-34
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226227763|ref|YP_002761869.1|
Sequence length 1079
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase precursor [Gemmatimonas aurantiaca T-27]
Sequence
MEQLSADRHCPSRRARVLAAALLLGAAAPTLAEGQSAKLDLVIATTTDVHGRLRAWDYYA
NAPDPAHSLAAAATIVDSVRAAHPGRVVLVEAGDILQGNPLTYVAARVSPPPVHPVIASM
NVMRYDAAVLGNHEFNYGVPLLRRAIAQASFPFLAANVQNANGSNFVAPWNMVTRAGVKV
AIVGGTTPGSMVWDRDNLKQAGVTVSDIVPAVKSSVAAARRAKADVVIVLLHSGLAERAT
YDTLATGLPSENVSARIPKEIPGVDVVVFGHSHREVVDTTIGGALVMQARNWAGSVGLGT
LSLEKVKGKWTVAARRGERVLVTNHKESPAVLAASVRTHETTRAWVQGTVGQTSVAWRAD
SARVADVPLMDLVAEVMLRETKADLAAVSAFSLDASLPAGGITRAMISRLYPYDNTLRAV
RITGAQLRAYLEHSAKYYRTLTPSGDAPSNGIIDPAVAGYNFDMIAGADYVLDLRQPVGQ
RVTKLQIRGRDVVATDSFTLAVNNYRQSGGGAYAMLATAPVVYARDTEIRQIIIDEIERA
KTIEPSGYFTPNWSIEPAAARELILRELLRGRRAETDGRSSASTMVGTPGQRMLRVIAMS
DFHAQLKPRFDGANPMGGAVALSAALRKAQGECVSPACESVIIDAGDLFTGTPASDWDSG
RPTVGVVNRFDIAAGALGNHEFDFSQDTLRVRMRELRHAVLGANVRGPDGKLPAWIKADT
IVQRGNLRIGIVGAAGTHTSSSAARRKVAGLTFIDPLPVYQERAKALRAAGAQVVLFVVH
DGGRCERDRPTVCEGEGIALGKRVAALGAERPDAYIMGHAHVNLTFDFEGMPAVEPTSSG
RGIVIIDLPIGGGAARTEIRPVRGDAIEGAEASVDSIVRVATARSEAKEQQPVATIASDL
RRRGNQYPLGNLIADAARTMGAGDVGMINNGGIRIDVRAGPLLFGGVHLISPFGNVLTRM
RVRGRDLKPMMERTFENGAPHAHVSGLLIEYDSSRADGDRIVRITMANGAAIQPDRIYGV
VMNDFMIDDLYTDLQKTAVSTEYLPLRDSDVLAEYLRRQPQPIQADTTVRIRPVTAGAR
Download sequence
Identical sequences C1AAZ3
379066.GAU_2357 gi|226227763|ref|YP_002761869.1| WP_015894168.1.17207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]