SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777711|ref|YP_007169498.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777711|ref|YP_007169498.1|
Domain Number 1 Region: 80-305
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 8.89e-84
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 8-80,306-514
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.13e-70
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777711|ref|YP_007169498.1|
Sequence length 532
Comment phosphoglycerate mutase [Halothece sp. PCC 7418]
Sequence
MADAPIAPVVLVILDGWGERQSKTANAIAQGKTPVVDSLREVYPLTFIQASGKAVGLPEG
QMGNSEVGHLNIGAGRVVPQELVRISDAVEDGSILENPVLVETCQKIKASDGKLHLMGLC
STGGVHSHISHLLGLLKLAKAQEISEVCIHVFTDGRDTNPTDGVSALEAIQNYIQQAGVG
KIVTISGRYYAMDRDRRWDRVQKAYEVITETECETEIDPIALLKEQYESDVTDEFIAPTR
VAAGGVEAGDGVIFFNFRPDRARELTSAFVNPDFDGFEREQIQPLHFATFTQYDASLPVE
VAFKPQNLTNILGEVIANAGLKQLRTAETEKYPHVTYFFNGGEEEPFQGEDRKLINSPMV
STYDKAPAMSAEAVTDLACEAVEQGIYSLVVINYANPDMVGHTGNLEAAISAIETVDHCV
GRLLESISKMGGTALITADHGNSEYMADEKGNPWTAHTTNLVPFLLVEGEKRKIPQHGGK
VELRDQGCLADIAPTILEILQIPQPEEMTGRSLIASSNVQVKPNRTPVDISL
Download sequence
Identical sequences K9YEK8
WP_015227156.1.10129 gi|428777711|ref|YP_007169498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]