SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428297027|ref|YP_007135333.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428297027|ref|YP_007135333.1|
Domain Number 1 Region: 466-619
Classification Level Classification E-value
Superfamily TPR-like 1.28e-29
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 
Domain Number 2 Region: 174-378
Classification Level Classification E-value
Superfamily TPR-like 6.56e-24
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 
Domain Number 3 Region: 342-463
Classification Level Classification E-value
Superfamily TPR-like 9.96e-23
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 
Domain Number 4 Region: 89-210
Classification Level Classification E-value
Superfamily TPR-like 2.35e-20
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 
Domain Number 5 Region: 19-123
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000948
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428297027|ref|YP_007135333.1|
Sequence length 1221
Comment hypothetical protein Cal6303_0263 [Calothrix sp. PCC 6303]
Sequence
MKDISEIIETITQLNREVVKLAEAGDFEASISIAKEAVKLGEKNIDEHPAFADSLNNLAE
LYRMQGYFVEAKPLYIKILNLRKRLLGDSHPDVAQSLNNLAAFYVSQGLFIEAENYFLAA
LDIWKIYLGDEHPEIATNLNNIAEVYREQGRFQESEKIHLQALNMRKRLFGDFHADIAQS
LDNLAVIYENQARYSEAETTHLEALEIRREIFGDENWQIAASLNNLAALYNSQGRFVEAA
ENYSQALELCKNCLGNEEHPYIAITLNNLANTYKNQGHYAEAEKTHFQALSMRKNIFGDE
HLEVAQSLSNLGDIYLIQGRYLDAEEVYLQADSIKKDLLNPEHPDIALSLHNLGVLYTYQ
GRYQQAEAKYLEALSLHEQSLGKNHPIVADNLNHLGSLYQEQGLFSDAEQKYLAALAIRK
NIFGEEHPDIADSYNKIAEIYRLQGRYSQAEGLYLEAYKLNKKLLGEIHPDVAAILSNLG
VLYDAQFKYSQAEPLFTEALLIVRTKFGDNHPQVASVLNNLAAIYGSMRRYLEAEEIHLQ
VLEIRKSIFGSEHPDIANTLNNLAEIYLAQGKYAEAEKYYSSALSVRIKFLGENHPDVAL
SLNNLATLYAATKRPDNALSHRIQASTIHDKLISNVFAFSSENDRLAFIDKIRGNFDLFL
SLIYQYFPNSETATQEAFDFILKRKGLTAASLAAQSQAFYNDRYPQLTGKFRQLSELNTQ
LVRLTSFANQTQNIANYQSNLTQLRSQYDNLQKQIASQVPEIQLSTQIPNRHAVASALPT
KSVLIEFVLFDVFDFQAIQANGETQWKSPHYLAFILPAGQADGVQMVDLGEADTIHNLIN
LFRLEASDGGEETLGWAKVKTTPQLQIKQYNPAAAVELSQIILSPILDVLTDCDQIIFAP
DGNLNLVPLQILPIYPSERSFLMDKYTVSYLGVGRDIIHSQHQPTTIGDTPIIIADPDFD
LAMANNNLPNLENPTKQELLDTLDIKLDIKVLPPAHGTRLLGASVAKKLKNARLYTGAKA
LSTCLTNSKCPSIMLIATHGLFIPDSRQSNPMMRSAVAFAGANTALLGGNLPKQAGNGFI
FAQDIAGLDLRANELTVLSACDTARGDIKIGEGVFGLRRAFASSGTKILVMSLWEVPGRA
TALLMEQFFEHYQNGVAAVEALQNAQNYIRNITVEELRKSDLGMEILTELSQVRGLEIST
NGNKKPLEHPFYWGAWICQGL
Download sequence
Identical sequences K9UUW8
WP_015196019.1.40975 gi|428297027|ref|YP_007135333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]