SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428297241|ref|YP_007135547.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428297241|ref|YP_007135547.1|
Domain Number 1 Region: 188-313
Classification Level Classification E-value
Superfamily TPR-like 0.0000000379
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number 2 Region: 91-181
Classification Level Classification E-value
Superfamily TPR-like 0.00000125
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428297241|ref|YP_007135547.1|
Sequence length 331
Comment hypothetical protein Cal6303_0499 [Calothrix sp. PCC 6303]
Sequence
MSPSITDSMVKAAIDAVASEHATTEEKIEMLIELAQGFQKQPKTQHDFENVNNLCHASLI
LYNEAQELCGEDYLLLKAKAKVGIAGTLQAIPSSQVDLLLQAKIEYEEALPVLQQLGTDV
EVAEAQMNLGLVLQSLANFGRVKIGESIAMYQEALRVFGWEDFPQEYAILHNNIAIACLS
NASQEHLQHALAVKSFETALSHLNMIEHPKEYAMLQNNLGNAWQYLPSSHPVENSLRAVK
AYQEALKVRNPHDTPLEYANTISNLANALSNIPDDLEKAELGNLNNLLQAQKYYQESLAI
FTQNQQLEQAEMISQILSDIHREITLISSMK
Download sequence
Identical sequences K9UX73
WP_015196230.1.40975 gi|428297241|ref|YP_007135547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]