SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428298080|ref|YP_007136386.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428298080|ref|YP_007136386.1|
Domain Number 1 Region: 765-925
Classification Level Classification E-value
Superfamily TPR-like 1.06e-31
Family Tetratricopeptide repeat (TPR) 0.0046
Further Details:      
 
Domain Number 2 Region: 686-802
Classification Level Classification E-value
Superfamily TPR-like 9.48e-19
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 3 Region: 21-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000204
Family RecA protein-like (ATPase-domain) 0.043
Further Details:      
 
Domain Number 4 Region: 539-717
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428298080|ref|YP_007136386.1|
Sequence length 1460
Comment hypothetical protein Cal6303_1356 [Calothrix sp. PCC 6303]
Sequence
MTGDYEYKVGGSLEEDAPSYVRRQADSDLYYGLKAGELCYVFNSRQMGKTSLLVRTMKRL
QADGFACAVIDISGLGSQDITLEQWYGSIVDSLLTELNFVEPEDLAVWWEKSIEITPVRR
LGKLFDELLLPNVNQNIVIFLDEIDSILRLDFPADDFFALIRSCYQRRSFKAEYKRLTFA
LFGVATPADLIKDEERTPFNIGTAIQLDGFRLDEIAPLAQGLEGKVENPQAVMREVLAWT
GGQPLLTQKVCNLLIQDLRNPTPTLARRGEIGGNEWVEGVVRSGIIENWESQDEQEHLKT
IRDRLLVNEQIAVALLGLYQQILQKGEIAVDGSFEQMRSRLTGLVVQQQGKLRVYNQIYG
NVFDLIWVENELGKLRFYADKLRAWVESNYQDNTCLLWGEDLEKSRVWADGRKLSDVDYR
FLSASLEAELNQKVAEAEGKQNQAFEEERKANKRLAEVERKTNQKIRNGLIVLTLSVFGV
ITALIFASSAEQRRSVATSQFNSTNSELDSKKIELSKAKESIKTLTRQQEEREKLIAIAN
SEKKQAETAKKQLEIKSKQANYKLNATNTKLQTANQQVKAAQQLFSEANNKVQSAEEEAK
NAKGEQKNANNLAQQARNELASAKKGLEEAQKKQQEAEKQAQIAEKQQKEAQQLLAKAKV
DLEIASRGVEKLNIAVVDIQQKIGESRALARNLTNTGEVYNSIGETEQALKLFNEALPIQ
REIRDYIGQGRTLSKIGTIYSYIGEPKKALEFFNQALPLQRTALDRAGEATTLDNIGAVY
QTLGERQKALEFFNKALSLRREVGDKAGEATTLDNVGSVYQALGESQKALQFFNQALPLR
REVGDKAGEATTLDNIGTVYQTLGNPQKALEFFNQALSLRRAASNRVGEANTLKNIANLE
RSRGNLNKSLTQLKTAININEDLSKNFINPELRAYYFSSVQDNYELYTDLLMQMHVQQPS
KGYDAQALSANERSRAMSFMEFLTESNSNIRQGANPELLARERSLQQEISALETQRLELS
SRRDTEKQVTETSQKITSLLEDYKQLQTKIRISSPRYAALKYPKTLSLQEIQQQVLDNNT
LLVAYSLGKERSYLWAVSKTSITSYQLPKRSDIEVATSNFRYSLGQPNTAANFAQEDGKK
LSSIILSPVANQLQQKRLLITADGILQTIPFAALPIPNNNEQDFTPLLVQNEIVNAPSAS
SIAVLRNQLKGRIPAPKTVAVIADPVFTSDDPRLTGKRPEIAPQLDLQFTGKRPEIAPQL
DLQFTHSGFARLPFTREEAEEILRLVPENKRFSAFDFAANYETVTSPKLAKYQIMHFATH
AFVDSQNLELSGLVLSQFDSKGNPKPSYLRLFDIFNLNLSAELVVLSSSDTGLGKEVKGQ
GIVGLTRGFMYAGSPRVISSLWQVSDQGTSVLMARFYRKMLVDGLKPSAALRAAQLDMLK
EEKWRNPFYWAAFTMQGEWR
Download sequence
Identical sequences K9UY67
WP_015197064.1.40975 gi|428298080|ref|YP_007136386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]