SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428298766|ref|YP_007137072.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428298766|ref|YP_007137072.1|
Domain Number 1 Region: 65-304
Classification Level Classification E-value
Superfamily TPR-like 1.64e-42
Family Tetratricopeptide repeat (TPR) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428298766|ref|YP_007137072.1|
Sequence length 368
Comment hypothetical protein Cal6303_2074 [Calothrix sp. PCC 6303]
Sequence
MHPAISVGITFMSLKYQFNKCFRSYSQRVFLACSVMLGLLIPSVVQVPGSRVLAQSVMTQ
DLEAAGLYQQGVIRYSRTDFQGAEMLLRQALQIDPNLAAARTYLGNIMLQQNRLDAAVQE
YGEAVRIDPSFAEGFFNLGLGLQKQGQQEAAITAYRQALVINPTMAGAHYNMGLALYEQG
QFADAIASYQQAISLDGSNANAYFNLAIALQQQGQNQAAMNAYRQVVQINPNSAAAYNSL
GNLMIMQGQTADAIATYQESVRRIPKNPEAYYSLGTVWYNQSEFKKANIAFQRAQKQYRE
QGNYQQAEKLEQLLQQIAQGNKNPGETLPTSEIPTAPETSQSPIQSNNPTEITPNNMIEF
GQPIPGKS
Download sequence
Identical sequences K9V1J3
WP_015197746.1.40975 gi|428298766|ref|YP_007137072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]