SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428298936|ref|YP_007137242.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428298936|ref|YP_007137242.1|
Domain Number 1 Region: 310-522
Classification Level Classification E-value
Superfamily TPR-like 1.58e-33
Family Tetratricopeptide repeat (TPR) 0.0076
Further Details:      
 
Domain Number 2 Region: 151-322
Classification Level Classification E-value
Superfamily TPR-like 1.9e-28
Family Tetratricopeptide repeat (TPR) 0.0046
Further Details:      
 
Domain Number 3 Region: 992-1147
Classification Level Classification E-value
Superfamily TPR-like 2.25e-23
Family Tetratricopeptide repeat (TPR) 0.073
Further Details:      
 
Domain Number 4 Region: 44-182
Classification Level Classification E-value
Superfamily TPR-like 5.56e-21
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 5 Region: 843-1025
Classification Level Classification E-value
Superfamily TPR-like 2.02e-20
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 6 Region: 719-868
Classification Level Classification E-value
Superfamily TPR-like 4.93e-18
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Domain Number 7 Region: 1117-1318
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000683
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 8 Region: 561-703
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000095
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428298936|ref|YP_007137242.1|
Sequence length 1811
Comment hypothetical protein Cal6303_2253 [Calothrix sp. PCC 6303]
Sequence
MSNRLKSFALASLVFSLTCGVGLAASDVVVKHTLAQTAASSDGKAEADKLFQDGVQQFRR
GEYPKALQTYQRVLEIRRKLGDKAGIGQTLNNIGQVYNGLQQNDKALEILQQALTVRREI
KDRAGEGETLDILGVVYLILEKDEKSLETLQQALAIRREVKDRNGEAATLSKMGFTYVFL
KKQEQGLKLLQEALALHQELKDKFQEGLTLFRIAQVYWNADDYPRALEWYNKSLAVNREV
GNRAVEGRSLQQIGTMYFKLEKYEQAIQYYQQALPLIREAGISPAEESIIASTGDAFNNL
KQYDRNIVFYQEELANAKKSNNKHLQGNIFKWIGSTYFKQENYDRALEFFQQALPFAAEV
KDKDFKANIIAAIGDCFFRKKQHQQAIEFYQQAVMAAREAGDTNFEGIVINQIGISYFLQ
KKYDSALKFYQQALPIAREISNKSLEAQILDSIGDSYLNLQQYDQAIAAYQQALPVAQEA
KNQGLTANILIGIGSAYSFQDNKEKSIEYYQQALKIQREIKDKPAILKSLLLVSSHYGSK
AVNFYTRGLIAQAKAGLPRRIEFAEEALNLAKELKQEAEEATCLYALGQSYLILGDNQKA
LEFSQQAVKIARDIKDRELENSALNNLAQIYASQGNTIKKIEVLERQVAIKREQKDLLGL
AYALVTLASDYAIAGKHQQQLETNQEALAIAQKIEISKLPSYLQENAQEVQLFAIDGLSS
SYENMGQLDKALEFANQQLKTAQSFGKLKFEAAALLNLAALYSNSFRDKLKSIDAAQKAL
KIARQIQEPRIEAQALQQLGDNYNELGDFSNALEAAQQLLNIAKRLENPRLERDALVIFV
NVYHDQGEFQKALSTAQQVVAITQQKNLGSEVTALGALSESYLSVGDTSKAVEAAQQILT
IAKQQNNPNYEILGLMYMGKSHKLRGEYQQGVTALEKALEITPNNKFFAGEIAAVGELAT
LYEALGEYQKLIALAEPRLPQVKQLKNPPVEAGILIVLGYSYSSIGEYQKGTELVEQGLA
IARELKNPALESMGLAKLGSIYNSRNDYQKALELTQQSLKIAQDIKSPPLMLEPQATLGD
IYHNLGDYTRSQEYYQQVLTIAQQLKNRRIEGTALLILSQINFRQNESQKSVDLAQKALK
IFQEIKEPRLEALANSIVSIGYADLENEQKAIESAKIYLAFARQVKNTAWEKTGLALIGH
IHRKFGRTEQAIVAYQQALAIKTENQVKGADAGIYAGLAQVYQNLNQPNVAITFYKKSVN
RLEEIRSGIEGLPKELQNSFLNSTFDFDKVKVSDIYRQLAELLIKQGKDKEALYVQDLLR
RQEISESTNTRSDSTEKPQIPLTETERKVPALNDSIIALGYQITECKPTNSQKCSQLTQK
RSEVITQYIQQLEGLNKLISDNRHKDDIFFDPTILGKIGEIVEASPNTVMIYPLVGEREL
HIQLYGKKGVVKTVTVPVGRVELGNAVKEFRSLMEKCEKLAYCGGEDITKVKAASKKLYG
WLIKPIEKELNANPVENLVFALDRVTRYIPTSALFDGNQYLIEKYSIYVAPSADLTNTTK
PSPSLSTGDTNILGMGLSDSVPQNGIIPAFNGLKSVPKELDFIVKEQNDSSDQQGIYNGK
TFLNSQFNFSIMQNNLKDNNVLHLATHGVFDPNSSQQSYILLGDKTLLNPIRIQTLVDLK
YIHLVVLSACQTALSSPNQEGIEINAFANYFLKRGAKSVMASLWKVDDPSTAKLMQDFYK
NLATGKMTKSQALRQAQLSMLKGNNYTVENGDKRGAYVDREEEALPRNEQRKSSYSHPYY
WAPFILIGNGL
Download sequence
Identical sequences K9V201
gi|428298936|ref|YP_007137242.1| WP_015197916.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]