SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428298975|ref|YP_007137281.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428298975|ref|YP_007137281.1|
Domain Number 1 Region: 153-332
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.7e-29
Family Prokaryotic proteases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428298975|ref|YP_007137281.1|
Sequence length 362
Comment hypothetical protein Cal6303_2293 [Calothrix sp. PCC 6303]
Sequence
MTQIQKPVTMTVQLSTPDFQRIIKIVSNLPGFGTTVYERRRFVEGAFGGEAKANTILVQL
NLDGLPMNVAVELVNFLCKFGQVAYGKEALGVFLNYIQLYTGEEDTSFIQDVFQRYPLDT
PASPNNLIDRWRGTDNLADIKEKIIGEDTLRHINILEMALDAARAVVLIDGNKKGTGFMI
SPNLLMTNNHVIASQEEAQKAEYIFNYQLDKNGKETPITIVNALAKGDFYTNAKLDFTVL
TLKNVPDFGNHLKLKNQRTQKDKRVAIIQHPGGHLKKISIQNNLVAYADNQDVQYTTTTL
PGSSGSPVFDDDFQVIAIHHSGGMLLEPNTTTKYLRNGGTSMMAVLKDLQTNASDIYAQL
QG
Download sequence
Identical sequences K9V0R6
gi|428298975|ref|YP_007137281.1| WP_015197955.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]