SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428299139|ref|YP_007137445.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428299139|ref|YP_007137445.1|
Domain Number 1 Region: 303-504
Classification Level Classification E-value
Superfamily TPR-like 6.45e-28
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 
Domain Number 2 Region: 2-245
Classification Level Classification E-value
Superfamily Caspase-like 0.000000141
Family Caspase catalytic domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428299139|ref|YP_007137445.1|
Sequence length 580
Comment peptidase C14 caspase catalytic subunit p20 [Calothrix sp. PCC 6303]
Sequence
MRRDALVVGINQYPFLKDTPTSPAKHLTTPAADAEAIAQLLENHGDFRVKRLPESIIEGK
LQVDPKKKVTTEELETAIANLFLPNSNNIPTTALLFFAGHGLRRTLDTQKQGFLAVSDTN
FSREKWGMSLEDLWDILQKSQVKQQVIWLDCCFSGELLNFRDTELGRQNSGCDRCLIAAS
RDYEVAYQQLDSKHGLFSSALIAGIDPYKNQENEWVTNEQLTIVVRQKLQKYYREKRISQ
IPQISNHGEAIKLILGKPNPLDKFLQALVRQVDNKLPFSTKIREELQEIQHHWNLKNEDI
ELLYIRLAKELYKQNRLQESIYIFKEALVVNPNNPIIHEQLAYILLENGQIEDAIHAYEY
VINLKPNNINLHVWFGTVFYRTNQLGRAIEAYKLAIKFSDNKSVDLAKIYYLLGKTFYQC
DIFNDDAVRSYEEAIKIKQDYPEAMAGLAMALYKAGNYLGACETLKKAIDFQPKNPDFRR
DLGIIFAGQGKYKDAIVEFKEAINQNAINSMPDPVAYTHYAFALLANNQKKKAESEIKLA
VELFRKQGMNDAAEQMEYLFEQIKKESSWGNLFKRFIANT
Download sequence
Identical sequences K9V022
WP_015198113.1.40975 gi|428299139|ref|YP_007137445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]