SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428299168|ref|YP_007137474.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428299168|ref|YP_007137474.1|
Domain Number 1 Region: 66-263
Classification Level Classification E-value
Superfamily TPR-like 1.48e-32
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 2 Region: 425-585
Classification Level Classification E-value
Superfamily TPR-like 2.09e-32
Family Tetratricopeptide repeat (TPR) 0.0072
Further Details:      
 
Domain Number 3 Region: 270-426
Classification Level Classification E-value
Superfamily TPR-like 1.48e-30
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 
Domain Number 4 Region: 545-708
Classification Level Classification E-value
Superfamily TPR-like 3.34e-27
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428299168|ref|YP_007137474.1|
Sequence length 1271
Comment hypothetical protein Cal6303_2511 [Calothrix sp. PCC 6303]
Sequence
MSQSPASRKSIFDTLPRLIYCGCISIFSLVLLSESVGAGVNINQLQISQQPTTTNQPNPT
RSEADKEAEKLTQEGLQLLKKDTPESLVVARKKFEAALILWEKLGNKPMHAVTLLLAGQI
NLSLNEQQKSLEYYKQALVLWRELGYKKEEAQTLNYIGRNYFNLGEKQKALEFYSQALPL
LQTLGDKSEEAKTLIYIGNIYSDLGEKKKALEYYNQTLSLWRALSNRGEEAKILNSIGLL
YDALGEKQKALENLNQALSLSRGAGDKGEETAILNNIGKVYSDLGENKKALEFYNQALPL
FRALNDKGREATVLNNIANIYSNLGEKQKALENLNQVLSLLRLVGNKRMEAIANNNIGAV
HSDLGEKKKALEYYNQALALFRAVANKDGEATTLNNIGGIYSDLGEKKKALEYYNQALTL
SHTLGNRSGEATTLNNIGMIYSDLGENKKALEFYNRALPLLRAVGERRVEAITLNNIGAV
YSDLGEKQKALEHVNQALSLYRVVGYKEGEATSINNLGKLYSDLGEKKKALEFYNQALSL
HRAVGDKEGEARTLDNIGGIYLDFGNKQESLKLRNQALSLRRALDDKGGEARTLNNIATV
HLALGENKKALEYFNQALLLLRALGDRNVEATTLNNIGAVYSDLGEKQKAIEFLKQALSL
DRVVGNKVNEARTLWNFAELERKQGNLQAARQHIENAIQIIEELRGTYTDQDLKTTYFAT
VQGYYKFYIDLLMELHKQDPSKGYNALALNTSERSRARGLVELLAQANAKLSKNIDPQLI
EREQELQTKRQAQEKNLAQLVNQPQVSRETIEQTEAEIQNIINQQKALKAQIRDRNPERD
KITNPQPLTLGQIQQQLDKDTVLLQYSLGQNRSFLWLVTPTSLTSYELPKEAEITKIANR
YHTALGDAATTNVAIESAQQLSQLILAPIKDKLANQLAGKRLVVVADGVLQQIPFAALHD
LNGNKGSGNMQNIPTNRQTDRRGVNIKPNSPSPGKTNTNYQPLFLNYEIVNLPSASTIAI
QREKTANRQPAPKKIAILADPVYTNDDERVTGKPRSLLGELELERSALDRSAQSLKRTGW
SRLPNTATEARGILKLFPPTLSLQAFNFEANYNWATSKDLSQYQILHFATHGFVNPDQPE
LSGIVLSLLDSSGKQIPGYLRLADLFERDYPAELIVLSACETGLGKNVSGEGLVGLTRGL
MYAGAERVALSLWKVNDEGTSVLMQEFYRQMLSNNLTPAQALRAAQRQLWQGSEWRSPHY
WAAFTLQGEWS
Download sequence
Identical sequences K9V277
gi|428299168|ref|YP_007137474.1| WP_015198141.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]