SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428299392|ref|YP_007137698.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428299392|ref|YP_007137698.1|
Domain Number 1 Region: 60-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.89e-47
Family Prokaryotic proteases 0.0000677
Further Details:      
 
Weak hits

Sequence:  gi|428299392|ref|YP_007137698.1|
Domain Number - Region: 285-371
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.0785
Family Calpain large subunit, middle domain (domain III) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428299392|ref|YP_007137698.1|
Sequence length 373
Comment peptidase S1 and S6 chymotrypsin/Hap [Calothrix sp. PCC 6303]
Sequence
MNRKLLQVITSASLTGFLVGGGTQIITHTLGIAELKPVMAQGKRSTSVVAQRSEEQTRIA
VYEKASPAVVTIKHGDVVGSGFIASPDGLVLTNAHVLENAPATVTVILKDETEVVADVIG
FQGEGLDLAALKIRDRRRLPTLRLAAPGIAKVGQSVYAIGSPFGLENSFTSGIVSRIDRK
RGWIQHDAAINPGNSGGPLLNSKAEVMGINTLLINPSGKSNAGIGIAIAVDQVQTFLVAL
QQSDSSLVAQQPQPRSSDKTSDRNLPVDGETVTATLKRGDSVLPNNTYYQVYTFAGRAGQ
QVTIEMNSNQIDPSLFLVSANQEKVIEQNDDISPNNFNARLVATLPEDGIYLVVANAFER
GESGKYSIRATLK
Download sequence
Identical sequences K9V1K7
WP_015198360.1.40975 gi|428299392|ref|YP_007137698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]