SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428300159|ref|YP_007138465.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428300159|ref|YP_007138465.1|
Domain Number 1 Region: 6-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-56
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 1699-1867
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.17e-48
Family Histidine kinase 0.00092
Further Details:      
 
Domain Number 3 Region: 1896-2013
Classification Level Classification E-value
Superfamily CheY-like 5.98e-40
Family CheY-related 0.00084
Further Details:      
 
Domain Number 4 Region: 1338-1519
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-26
Family GAF domain 0.0076
Further Details:      
 
Domain Number 5 Region: 1512-1625
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.14e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.023
Further Details:      
 
Domain Number 6 Region: 1628-1711
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.81e-22
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 7 Region: 297-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.9e-19
Family Extended AAA-ATPase domain 0.052
Further Details:      
 
Weak hits

Sequence:  gi|428300159|ref|YP_007138465.1|
Domain Number - Region: 1219-1281
Classification Level Classification E-value
Superfamily TPR-like 0.0019
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428300159|ref|YP_007138465.1|
Sequence length 2015
Comment PAS sensor protein [Calothrix sp. PCC 6303]
Sequence
MKLPQIKGYTILTQISVSDRAAVYRAVRHGDRRSVIIKVLRSTQPSQNELIQLCNQYTIS
LHLPIPGIPAPLGLEPFYNSYAFVMEDCGSISLKEYLKTHSLSLTQILNIAIQLAHILHD
LAHHRIIHKDIKPANILIHPTTHHVKLIDFGIASRLPKETAQIVTINQLEGTLAYIAPEQ
TGRMNRGVDYRADFYSLGVTLYELLTHQLPFPSDDPIKLVYCHLAQQPTAISQLCPNLPL
VLSDIVSKLMAKNAEDRYQTALGLKYDLELCLSQWQQGEQIDRFAIATQDLSDQFSIPEK
LYGREAEVQTLLNTFERVAQGNSELLLVSGFSGVGKTAVINEVHKPITKQQGFFISGKFD
QFNRNIPFAAFVQAFRQLMGNLLTSSDAQLQIWKSKILAALGDNAQVMIEVIPELQSIIG
IQPPAPELTGDAAQNRFNLLFPKFVRLFAQPEHPLVIFLDDLQWADLTSLKLMQLLIAGE
SSSSYLLMIGAYRNNEVSPNHPLMLTIEQAIASRTTVSQIEIPALTQTNINRLVADTLLC
TTALALPLTELVYRHTNGNPFFTTQLLKRLHQDGAISLDRPANCWLFDPLQVSIDALTDD
VLNLMVQQLARLPKSTQELLQLAACIGNKFDLQTLTIVGEQKSDLVAKNLLPALQEGLIL
PIGETAKLFSSSESMPLDDALTISYKFLHDRVQQAAYSLITEDEKQSIHHSIGLLLFRNT
LPEEREARLFEIVNHLNIGSDRIAHPQERKQLAELNLTAGRKAKTATAYESAIAYFTMGI
ELTPAPGWEQHYPLMLALHQEIVEASYLNANFEQVEQLARPVLQQAKTLLDTIKVRQTQI
AVAKAQGQFLAAIQIGLKVLNNLGIEFPSQPTQADIDQAFGQTRLLWNHTAPIGLLDLPL
MSDPRLLATMEILTSLSPAAYIAAPVLMPLLMFKQVELSIQFGNCPVSIHSYHDYGLILC
GIIGDIDNGYNFGELSLSLLEKFQLPAAKCRSWCVVHYFIKHWKKSLCEILPRLQEASLS
GLDSGDLETAHMSTYFYCQYAYFVGQELNKLSQTMDAHLRTMFKVRHTGFISAHQIAQQT
TLNLLGQCNPPYILSGQVFNSEISVPQLKSINQRAALFQVYFNQMVLYYLFGKAPEAAES
SAQAVEYLDGVVASFSVPIYFWFDALVQLAEYETASLSRQQDILIHVQQLQDKLNYWATM
APTNHQHRCELVVAEQNRVLGNKIDAMEAYDRSILCAKTNGFIQDEALANELAAKFYLEW
NKPKIATVYMQEAYNCYQQWGAKAKTDDLEQCYSDSLNLDIRQSLQLDINQVTNIDDIDR
LIITSNSNSSTGNPEVDLAAILQASQSLSRTMELQDILQQLTQIILHNSGADYCVLMLPN
NDGNWYLEAIAIPEATTVCQVPLAENDQIPLRLIQYVKNSHMAVVIDDLDTDLPVIDEYL
QHHHPKSLLCLPLLNQGKLTGIFYLHNQLTSRVFTPDRLQVLNSICTQAAISLKNVYLYQ
TLRQSENKFRELVENISDLIYSITPEGNFSYLSPQFYDLFGYEVDLFLHQSLGVLIHPED
LPHIISANQQLFNTGEKQTGLEFRMKHQAGYWVWVTCNNAPMFDPLGNIIGFYGILRDIS
DRKQAELQLQQTNEELIRATRLKDEFLANMSHELRTPLNAILGMTEALTEEVFGAVNERQ
LKSLETIEGSASHLLEVISDILDVAKIESGHLELKCAPTSVNHICQSSITFIKQQAHIKR
ITIETKFPPNLPDWMGDERRIRQAMINLLNNAVKFTPEGGRITLEVKNSEPGFLQVSITD
TGIGISPQNIKKLFQPFIQIDSSLNRQYDGTGLGLALVKRIVELHGGSVGLTSEVGVGSC
FSFKLPCVDATAQSLSLESTTLAETLESEAPAVTSPLVLLAEDNEANISTIYSYLEAKGY
RIVVANNGQEAIDLVQSARPDLVLMDIQMPGMDGLEAMQEIRRNPQFADLPIIALTALAM
TGDREKCIAAGANDYISKPIKLKNLAQTIQAALVD
Download sequence
Identical sequences K9V320
gi|428300159|ref|YP_007138465.1| WP_015199120.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]