SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428300467|ref|YP_007138773.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428300467|ref|YP_007138773.1|
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-54
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 1792-1957
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.81e-36
Family Histidine kinase 0.0046
Further Details:      
 
Domain Number 3 Region: 1347-1525
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-27
Family GAF domain 0.0067
Further Details:      
 
Domain Number 4 Region: 300-579
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.29e-17
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 5 Region: 1519-1649
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.068
Further Details:      
 
Domain Number 6 Region: 1689-1729,1759-1790
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000135
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428300467|ref|YP_007138773.1|
Domain Number - Region: 1210-1290
Classification Level Classification E-value
Superfamily TPR-like 0.000106
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428300467|ref|YP_007138773.1|
Sequence length 1958
Comment multi-sensor signal transduction multi-kinase [Calothrix sp. PCC 6303]
Sequence
MLTTQVNIPGYQVDKQIYNGCKTIVYRGYRESDSLPVAIKLLKNPYPTFSELVQFRNQYT
IAKNINSSLILQTYSLETYKNSYILIMEDFGGISLNQWEGKEKISANLVDFLQIAIALTD
ALDILYRHNIIHKDIKPANILINPDTKKIKLIDFSIASLLPRETQIPTNPHGLEGTLEYL
SPEQTGRMNRGIDYRTDFYSLGVTFYELLTGGLPFQSDDPLQLVHCHIAKQPPHTAHNGE
IPQVLWDIIMKLMAKNAEDRYQSALGLKCDLENCLSQIKEAGKIEDFKIAQWDLCDRFII
SDKLYGREAEIATLLTAFERVTCGATEIMLVAGFSGIGKTAIVNEIHKPIIQQQGYFVQG
KFDQFNHNIPLSAFVQALRDLMRQLLSESDSKIEYWKSQILSAIGNNGQVIIEVIPELEQ
IIGSQPIVPQLSTNAAQNRLNLLFQKLIAIFTRKEHPLTIFFDDLQWADSTSLNLIKLLT
TEITPGYLFIIGAFRNNEVSSNHPLICTLNEIKNAGITINTITLLPLSVSDNNRLIADAL
KCTLEESLDLTKFIYQKTQGNPFFNNQFLKSLKENGSITFNMDAKAWEFDINQIYTLDLN
DDVVDLIVTQLKNLPQSTQNSLKLAACIGTSFKLKILSIITEKSQIDTANDLWQALKEGF
ILPRNEASKFSQSNIVQDNNKLDNIFIFEDCEYKFLYDRVQQAAYSLIPEEEKPATHLKI
GQLIIENNSPENCQENIFEIVNQLNIGRALINQESEREQLIILNLTAVRKAKAATAYSAA
SNYLAICIELLPFDSWNSHYDLTLKLYEEAVEIAYLNADYQLMEEMIEIVLSQAKTLIDK
IKVYETKILAIKAKSQLRESIEVGLELLKLLDVEFSKQPTSEDIGEALTETLLAWKEISI
PSLLGAKEMSDPIKLAAMRILTQLTPSAYQAFPSLMPLLIFKQIIFIIAEGNCPISAFSY
ADYGLVLCGIVGDLDAGYKFGELALNIIDRFQGDFYKCRTYFIVYSHIHHWKSPLSASLP
FFLEAYQVGLAHGDLESSALNAQMYCCHAYFVGKELVALASEMDIYRQAVEELKQQGALT
SLEICQQTVLNLLGHSDDPCQLVGDIYDENESLPLLKTLHNRAAIYHLYYHKTVISYLLG
KYQQAAFYASLVESYADIMPAAFTIPLFNFYNSLLSLQLYTYAETKQEKNNYLKKVVTNQ
RQLKQWSNSAPMNHLHKFYLVEAEYHQLLANYQEAIEYYDRAIRLAQENKYIQDEALANE
LAAKFYLTWGKERIAQSYIIDAYYCYVHWGAKVKIEDLEQRYPQLLAPILQKQQQSLNAN
EIIPIASFHSSKAATLGINSISETLDLATIIKASQTLSREIELDKLLIALLEVLLENAGA
DKCVLLLPKNEQWVIEGICQLGQSPIVLQSIPMQLGQYLPISLINSVKHSLKASVIFNAV
AHANLAVDPYVLHQRPKSVLCTPILNQGKLVGILYLENSLTTGAFTSDRLELLNLICTQA
AIALENARTYQQAQNYGKQLEQSLEALNASEARFQKLADNIPGVIYQLRLNQNGSFSMSY
ISSGCYELYEVTAEELISTGRSIRSFEHPEDVTKIDEAILNSAQNLTPFQYQWRIITPSG
QIKWIQALSQPERQENNELIWDGVILDISQRQAALQERKRAETERQKKAEALETALQELQ
QTQIQLVQNEKMSALGNLVAGVAHEINNPIAFLGGNIQPALEHIQDLFGLVDLYQEKYPH
PEAEIENEIIAIDLDYIREDLPNLVGSMREGVKRICEISNSLRTFSRKDSNCPVACNLHD
GIDSTIMILKHRLKASDSRPEIQIIKQYGEIPSIECFAGQLNQVFMNLLANAIDALEESN
IGYTYAQIKANPNLIIITTQIADNPRQIIISIKDNGKGMTPEVKQKIFDHLFTTKSVGKG
TGLGLAIARQIVVEKHHGAIDVNSTLGEGSEFLIRLPF
Download sequence
Identical sequences K9V4N6
gi|428300467|ref|YP_007138773.1| WP_015199426.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]