SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428300545|ref|YP_007138851.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428300545|ref|YP_007138851.1|
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily TPR-like 0.000000000018
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428300545|ref|YP_007138851.1|
Sequence length 140
Comment hypothetical protein Cal6303_3963 [Calothrix sp. PCC 6303]
Sequence
MTETIETLFDTGLERYKAGEPISDLIPVFQEVCDRAPKSSPAWTCLAWLYLLDNKATLAT
KAAQKAVKLNPQDPQARVNLAVAMLETKQKGLREHVEFAQQLIFVNEEWREEIKASIQDG
LTRKPDWQSLQKVSNWLFES
Download sequence
Identical sequences K9V594
WP_015199504.1.40975 gi|428300545|ref|YP_007138851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]