SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428300977|ref|YP_007139283.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428300977|ref|YP_007139283.1|
Domain Number 1 Region: 29-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-53
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 1797-1974
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-36
Family Histidine kinase 0.0037
Further Details:      
 
Domain Number 3 Region: 1352-1533
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-28
Family GAF domain 0.0054
Further Details:      
 
Domain Number 4 Region: 317-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.93e-19
Family Extended AAA-ATPase domain 0.057
Further Details:      
 
Domain Number 5 Region: 780-904
Classification Level Classification E-value
Superfamily TPR-like 0.0000126
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 
Domain Number 6 Region: 1224-1300
Classification Level Classification E-value
Superfamily TPR-like 0.0000632
Family Tetratricopeptide repeat (TPR) 0.082
Further Details:      
 
Weak hits

Sequence:  gi|428300977|ref|YP_007139283.1|
Domain Number - Region: 1705-1745,1775-1803
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000129
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 
Domain Number - Region: 1531-1598
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00067
Family Heme-binding PAS domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428300977|ref|YP_007139283.1|
Sequence length 1982
Comment multi-sensor signal transduction multi-kinase [Calothrix sp. PCC 6303]
Sequence
MIYGIFGNNIPVNNYECMKMSMTDLSIQIPDYKIKEQIYGSLKTTVYRGMREYDQLPVVL
KLMNLEYPNFSEVIQFRHQYTIAKNLNIPGIVKPYTLEVYDKGYIIVMEDFGGISLNQWQ
KPISLNDFFNFAIQITEILQQLHHHRIIHKDIKPANIIVNPQTQEFKLIDFSIASLLPRE
TQQLQNPNILEGTLSYISPEQTGRMNRGIDYRTDFYSLGITFYELLTGNLPFMSNDPMEL
IHAHIAKLAVNPHIINPGIPQALANIIQKLIAKNAENRYQSASGLKYDLETCLFQYQNTG
KITSFELGLYDVCDRFLIPEKLYGREKEIDTILTAFERVSSGETEMLLVAGFSGIGKTAV
VNEVHKPIVKQKGYFIKGKYDQFQRNIPFFAFVQAFRSLIKQLLGESDIQLKRWKTEILQ
AVGENGQILIDVIPELEKIIGKQPTSMQLSGNAAQNQFNLLFQKFVRIFSTIEHPLVIFL
DDLQWADSASLKLLKILVEDIDYLLVIGAYRDHEVSPTHPFIATIDDIYKTEKIVTTITI
QGLNTEHINQLIVDTIKCEPAAAGLLSNLVYQKTKGNPFFATQFLKSLYEDGNIYLELGT
WQCNLAEVKKLALTDDVVEFMALQLQKLPTPTQNVLKLAACIGAQFDLDTLALVSQKSPE
DTATDLWKALQEGLVIPTNDIYKFFSSLENLAMIPSQEIDFNPTYKFLHDRIQQAAYYLI
PEAEKLITHLNIGQLLLSKIDLIEDKLFDIVNHLNLAVSLIVETDRKLELTRLNLSAARK
AKASTAYASAANYLNCGIKTLPKNSWESQYELTLELYQNAAEIFYLCGNFQESDKFIQVV
IQKTSSIIEQVKSYEIQIQSYLAQNRLEEALNISLSVLKLLDFKIPNNPNKVQTLFCLGK
TKLRLMGKSPQVLANLPDMDDPKQLAIMRILTSSLSAAYISRPELLPLIVLNMVNISITY
GNSYLSSFGYAWYGLILCGVLQDIKNGYQFGRLSLKLQEKFNHPATKTKNIFMVYTFIEH
WCQPVQKNIDLLLESYQHGIEWGDLEYSSWTAGTIVFNQFFGGKELSDLEQQAKFYNASV
GHFKQNNALTYIKIFYQAILNLQQDSPEPYRLKGVIYDQDLQVPIQIESKDESGLFFLYS
TQVFLCYLFGEYRNAIDSEKLGKKYLPSGAGLFPTIQFYFYPSLAELALYETCSKEEQKQ
FFTEVKTRQKQLKKWADHSPNNCLHKWYLVEAERYRILGKKEQAIACYDQATNLAKQHQF
NHEEALAQELTAKFYLAWGKEKVAQSYMLDAYSAYSLWGSQAKIRDLEKHYPQLLAPVLQ
QQSLMLREIIPNQIYHTNSKTISAKLGQKLDLATVVKAYQSLSSEIEQEKLLSTLLLVMI
ENAGADKCVLVLPKDQEWVIEAISQLEKPTILMQSISLNIGENLPISLVNTVKNTLKAIV
IEDATRDQSLAVDPYIISQKSQSILCMPILNQGKLIGILYLENSLTAGVFTSDRLELMNL
LCAQAAIVLENAKLYQALQQVEIELRKQTQQLEKALQTQQRITATLESQREASFDGILIV
DENRKIVFHNQLFREIFQVPDKIMHTFDDHQLLQYVMAQAENPVAFVTKIEYLYQNPDLT
SHDEIALKEGRTLERRSMGVRTTYVGEASPEGKNYGRIWYFRDISEAKRDEVIRKETEVL
LKKQADELLQAFRELQQAQVQLIQSEKMSALGNLVAGIAHEINNPVGFLSGNIQPALEYI
QDIFSLVDLYQQKYSDSDPEIQDKIEEIDLDFVRTDLPNIINSMYEGIRRIQGISTSLRT
FSRADCEHPVAYDIHDGIESTILILKHRLKANEYRPEIQVICEYGELPQIKCFAGQLNQV
FMNILANAIDALEESNGERSFADITHEPNYIHITTAISEDFEQVMINIKDNGKGMTQEVK
EHIFEHLYTTKGVGKGTGLGLAIAYQIITEKHGGTIDVKTSLGVGTEFTIVIPIQASVKE
DF
Download sequence
Identical sequences K9V646
WP_015199932.1.40975 gi|428300977|ref|YP_007139283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]