SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428301162|ref|YP_007139468.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428301162|ref|YP_007139468.1|
Domain Number 1 Region: 22-285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-56
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 1668-1836
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.71e-37
Family Histidine kinase 0.0034
Further Details:      
 
Domain Number 3 Region: 1361-1541
Classification Level Classification E-value
Superfamily GAF domain-like 8.51e-30
Family GAF domain 0.003
Further Details:      
 
Domain Number 4 Region: 315-594
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-20
Family Extended AAA-ATPase domain 0.051
Further Details:      
 
Domain Number 5 Region: 1567-1607,1637-1668
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000373
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428301162|ref|YP_007139468.1|
Domain Number - Region: 1159-1309
Classification Level Classification E-value
Superfamily TPR-like 0.0398
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428301162|ref|YP_007139468.1|
Sequence length 1839
Comment multi-sensor signal transduction multi-kinase [Calothrix sp. PCC 6303]
Sequence
MGTITTQTKYIQWCELIITMNIYLPGYEINEQIYSGSKTLVCRAMRESDGKCVIVKLMRN
EYPSFSELVQFRNQFIISKNLDIDGVVRPLSLETYNTFYALVMEDFGGISLDEYFHESKP
KELHEFFDVAIQVVVALDALHRCRIIHKDIKPANILINPDTKQVKLIDFSIASVLPRETQ
QLKNPNTLEGTLAYISPEQTGRMNRGIDYRTDFYSLGVTFYRLLTQQLPFITKDPMELLH
CHIAQKAENVTSINPDIPKQLAAIVSKLMAKNAEERYQSALGLKYDLERCQKYWHQQRDI
PAFLLGQRDLCDRFIIPEKLYGREDEIKQLLTAFERVSHGDTEVMLLAGLSGIGKTAVVN
EVHKPIVRQRGYFIRGKYDQFQRHIPFSAFVQSFRDLMGQLLSESDTLLQYWRSTIIEVL
GENAEVIIDVIPELEGIIGKQPAVVELEGTASQNRFNLLFKNFIKIFATSEHPLVIFLDD
LQWADSASLKLMQMLASETDSGHILIIGAYRDNEVSATHPLLLTLKQIRLSGTVVNEVAI
APLEIEHINNLVADTLNCSEIVALPLAQLIYQKTKGNPFFCTQFMKVLYEEGLLIFDLDS
RSWECNISAVRERALTNDVVELITQILQKLPASTQKVLQFAACIGNEFDLNSLSIVLEKN
YTDTATDLWKALQEELILPKNETYKFFHSDSKNISSQSEPIKIDETQIKIRYKFLHDRVQ
QAAYALIPETQKQETHLKIGRLLLEKSSETEREENIFDIVNHLNTGIKLIEILAERQVIC
ELNLFAAKKAKAATAYMAAQQYLDMGINLLRSNCWEEQYEFTYSLYREKIEIEYLNGNFD
NSEELTYQILKKVRSNAEKCDILNTLIIQYTLNYKFIESIKIGRDALKLLDINLPEDNFY
EELQAEYTEVNQLTSQRKVSSLINLPVMESQEKIIAARLLMNLDSVAYIGMPQLFPIVAL
KLVKLSLQYGNTPESARGYSDYGVLLGSIFQNYQAGYEFGTLAINLSNFFNTPALKCRTY
FVFASFINHWYKHVRFSNPINDDAYRYGLESGEFQNSGYSLWGKTLNLFCQGANLNDMLQ
DFSGFVDFSEKTHNVSTTDAIESIELVVRNLAGLTGSYGEFSTSYNSELEYINRCESRKS
FLGLCSYKVMKCQVLYIYGDWEAAYEYAIAAKEIIQYVLGFYCTAVHNFYYSLTLVNKYE
NTSDVKLKSEYFEQLQTNQLQMKKWADSCPENFLHKYLLIEAEIFRVDGNHTQAMEAYDN
AINLARENQYVNEEALAGELAAKFYLGWQKSKIAQVYLTDAYYAYARWGAKAKVKHLEQS
YPKLLIFVNQTHEVTTTETLVLSATQTGSSSSSLMTSVFDLATVLKASQAVSSEIDLKRL
LMVLMEVALENAGASKAALVLIKNGQMFVEAVSQSIKSNNTVHSDSLPLEESMEVPISVL
NYVKNSSKYLLIDNTTKHVNWLSDNYIQQYQPQSLLCLPIRRQSQLVGFLYLENRNTAGV
FTSDRIELLQLICSQAAISIENAQLYERSQDYAKELESSLANLQITKEQLEISLEDVKQI
QIQLVQSEKMSALGGLVAGIAHEINNPIGCISGNIEPAEQYIEDLFEIINLYQSEHPEPS
QKLRRKIDKADLEYINEDLPKLLASMKQSIDRIYNISVSLRTFSRSDTHKPIVCDIHECI
DSTLLILRHRLKASELRPEIEVIKNYGDINPFACYPGQMNQVFMNLLANAIDALDESSTG
ISFEQIKANPNEITITTSLDNDKTSVLISLRDNGAGIPEDVKNKIFDHLFTTKTIGKGTG
LGLAIARQIVIDKHGGSIHVNSSVNQGAEFVIRLPFIRN
Download sequence
Identical sequences K9V6N2
WP_015200112.1.40975 gi|428301162|ref|YP_007139468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]