SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428301299|ref|YP_007139605.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428301299|ref|YP_007139605.1|
Domain Number 1 Region: 9-68
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.49e-17
Family Chaperone J-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 95-169
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000134
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428301299|ref|YP_007139605.1|
Sequence length 206
Comment heat shock protein DnaJ domain-containing protein [Calothrix sp. PCC 6303]
Sequence
MSDVPIDTNQAYGILGLKPGASLDEVRKAYRGLVKKCHPDCFTDLTEKQEAEEIIKKINA
AYRILKSEVSVSSDFSDAVESAVPKSPNKTKIYAKTSSAERFYESGVENVQLGKYENAIA
DFTQAIKINPNYIEAYKYRGLVCSQLGYEYRATADLSKAAQLERRYRGKYSKSPAQPYYS
TYQRSKKNRSPIHKLCQTLKRWLRLG
Download sequence
Identical sequences K9V6D6
gi|428301299|ref|YP_007139605.1| WP_015200247.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]