SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428301507|ref|YP_007139813.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428301507|ref|YP_007139813.1|
Domain Number 1 Region: 132-267,302-348
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000778
Family Transcription factor MalT domain III 0.048
Further Details:      
 
Domain Number 2 Region: 42-142
Classification Level Classification E-value
Superfamily TPR-like 0.000000000111
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 3 Region: 394-486
Classification Level Classification E-value
Superfamily TPR-like 0.000066
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428301507|ref|YP_007139813.1|
Sequence length 908
Comment hypothetical protein Cal6303_4944 [Calothrix sp. PCC 6303]
Sequence
MNKRLFQKVFIAIFTTLMIIVNPLFPININTSNTIAKAQDIANNPQNLLDKAQLLYQSGK
FLDAAIALQTAATIFQQQGDKLKEATTLTNLSLTLNKLGQTDKAESTIIKSLNILTQLNS
NLQNTSTQKILAESQEIQGQIQLDLGKTEQAIDSWKKSANIYISIKDESGFTRSLINQSI
AQQNLGLYHQSRATLEQISPLLQKQQDSRVKAIALRSLGDVLQLVGDLDKSQEILQQSLD
ISKKVKSPTEISSTLISLGNNQMALGRRGSLQYSQADYSNFTPLTCVIDQSIKQSSTTSK
NYSLANQLYTEAAAKSSSEIIKIQAELNHLQALQKLQKWSESENISRQIKSRLKKIPINQ
NTIFAQINLAQNSICLKKALNSNLITWREIADDLATAIQESRKIKSQRYEAYALGVLGGI
YLEIKDILNAKKLTEEAVILAEKIKAIDIAYLWQWQLGYILNLQGNKKHAINSYIEAVNT
LKSLRNDLVALNSDVQFSFRDNVEPVYRQFIDLLLQPENKNNQNYQISQNNLFLAREALE
LLQLTELENFFKVSCLLPQPKQIDEIVDKTDPTAAVIYPIILKDRLEIILKLPNQSQFRH
YTIYETADKIENTLDKLQQYLREPDRINNVKTLSTQLYQWLISPLEADLANQSIKTLVFV
LDGALRNIPMGVIYDQKNNQYLIQKYAIALAPGLQLIESTTLKRKNLEILAVGISKEREI
DGRKFAELKNVATELEQIKTTITSSKGMINQNFTIKNIQNQIKEIPYTVVHIASHGEFSS
NANKTFILTWEELLKVRDFDRLLRLRSQSESRAVELLVLSACQTASGDKRATLGLAGVAV
KAGTRSTVATLWSVDDESTTEFMSQFYQELANMKLSKSEALRRAQIAILDKYKTPFYWAP
YVLVGNWL
Download sequence
Identical sequences K9V7M3
gi|428301507|ref|YP_007139813.1| WP_015200453.1.40975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]