SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428301738|ref|YP_007140044.1| from Calothrix parietina Calothrix sp. PCC 6303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428301738|ref|YP_007140044.1|
Domain Number 1 Region: 69-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-65
Family Prokaryotic proteases 0.00000968
Further Details:      
 
Domain Number 2 Region: 271-400
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-22
Family HtrA-like serine proteases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428301738|ref|YP_007140044.1|
Sequence length 404
Comment HtrA2 peptidase [Calothrix sp. PCC 6303]
Sequence
MQIPKLTHSIRQFRSKMLALSISVVFIAGTISVLPVQAQLVTNTTNTAQITSQKPSAATA
AIGNSSFVTSAVNRVGPAVVRIDTERTITRRVNDPFFDDPFLRRFFGDNLPQQLPPEQQR
GLGSGFILDKSGFVLTNAHVVDRADKVTVRLKDGRSFEGKVQGIDEVTDLALVKINAGGD
LPVAVLGSSSQVQVGDWAIAVGNPLGLDNTVTLGIVSTLRRTSRDVGIGGNKRLEFIQTD
AAINPGNSGGPLVNASGEVIGINTAIRGDAMGIGFAIPIDKAKAIASQLQRGEKVAHPFI
GIGMEDLTPELAKTINSNPNSPIQLPEVKGILVARVVPNSPAASAGIRPGDVILQVDGKL
VNNGEQLLNIVEQSRIGQTLQLKVQRGTQTQQLSIRTAQLQDAS
Download sequence
Identical sequences K9V9I6
WP_015200682.1.40975 gi|428301738|ref|YP_007140044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]