SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167038940|ref|YP_001661925.1| from Thermoanaerobacter sp. X514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167038940|ref|YP_001661925.1|
Domain Number 1 Region: 534-849
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.28e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00052
Further Details:      
 
Domain Number 2 Region: 33-341
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.69e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 340-531
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.4e-54
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000455
Further Details:      
 
Domain Number 4 Region: 850-1064
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.45e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|167038940|ref|YP_001661925.1|
Domain Number - Region: 1113-1150
Classification Level Classification E-value
Superfamily SH3-domain 0.0017
Family SH3-domain 0.0034
Further Details:      
 
Domain Number - Region: 1187-1215
Classification Level Classification E-value
Superfamily SH3-domain 0.0523
Family SH3-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167038940|ref|YP_001661925.1|
Sequence length 1284
Comment 5'-nucleotidase domain-containing protein [Thermoanaerobacter sp. X514]
Sequence
MFRSRSRILAIFVAAIMVFSMFFSAIPQIAFAATSKTFDFIVVTDFHGYLQNDGKLSDGT
TYKQQIAGVLAKQIKDIKAQNPDRTVILSGGDMFQGTPLSNVLKGQPVIEMMKNIGFDAM
TLGNHEYDWGIDSVIDTQNATLKNSTIPVLAANVYDKTTGQLVNYVKPYVMIEKDGVKIG
IIGIVDNKEFPNIIMPAYIQNVEFKDPVPIVNDLAQQLRQQGAQIVVVLAHMGAYQDKSG
NATGNLIDFAKQVQGVDAIFGGHTHSIVTTRVNGIPVGVAYYYGRGFIDLKITLNDDGTV
TTGDMQYIDITGLYSTQNPIVDPEVQAIVDKAVQDVGPIFNEVIGQAAIDLTRTQSAQPY
GDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDITVGMMYQLMPFDNTIVTMKMTG
AQVKTILEQAVQDGGKGIQVAGLTFKYDPSKPSMQRVFDMRKSDGTPILMDKTYLVATNN
FMGTGGDGFTGFTDHDVAKTYIDTYKLVRDAFIDAVKAQKTITSKIDNRIAPAKMSDATI
TVLATSDIHGNIFTWDYNTAKPANRGLAKVATYVKQVRAQYPYVVLVDNGDTIQGTPLSY
YYNKIDTETEYPLAKVMGAMKYDTWTLGNHEYNYGLDVLNRVIKDMRSEGIHVLSANTYK
DDGTNFVDPYYIKTFDTPQGPVKVGILGLTTKTIPSWEDKDHYAGLHFNDLVEEANKWVP
KLREAGADIVVVTMHSGEEKPTDIIPENQVIAVATQVNGIDAIVAGHTHANIPQRTYTNS
AGQTVIVTQPGRWGEYVSQINFNISKNADGKWVIDSKWSATIKMDDSVQADPDILNLAQP
YQDATLKYIGTKIGVAAGDFLGTEQTVKETAIMDLINKVQKYYAKTDLSIAAPLSSSAKI
LKGDITIQDIMGVYVYENYLYGIKMTGKQLKDWMEWSARYYKQVSSPDEPITKDPTLNIP
DYNLDQLYGASYVIDLTEPAGHRIKNLKVNGKLVKDDDVFTVAINNYRFNGGGGFMQAAG
ITNPEIVFDSAKAYGDDGQVRNLMIRYIQEHGTITPTVENYWYISTTPVEEEIEAPAPQP
APQPVYNYGIVTASALKVRTGASTSSKIIGVLPAGKVVTLLEEVNGWYKIAYNGKTGYIY
GKYVAATPDPSNVVVLKAVKVTAKSGLNVRVGSSVTARKIGAVPYGTELKVVKEENGWYM
VQYNNSFGYVYSGYTNDKASSAILKTVKVTAKSGLNVRTGNSINAKKIGAVPYGTLLKVV
GEYNGWYQIQYKGGFGYVYAKYTK
Download sequence
Identical sequences B0K281
399726.Teth514_0272 gi|167038940|ref|YP_001661925.1| WP_009051871.1.26562 WP_009051871.1.81593 WP_009051871.1.95568 gi|307723515|ref|YP_003903266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]