SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736180|ref|YP_007055724.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736180|ref|YP_007055724.1|
Domain Number 1 Region: 98-324
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.48e-82
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000221
Further Details:      
 
Domain Number 2 Region: 26-98,325-533
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 4.32e-71
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736180|ref|YP_007055724.1|
Sequence length 554
Comment phosphoglycerate mutase [Rivularia sp. PCC 7116]
Sequence
MSVNGIIRILRKVKGSFVMTKAPVSPVVLVILDGWGYCEETKGNAVAASSTPVVDSLIKA
YPNTLINTSGKAVGLPEGQMGNSEVGHLNIGAGRVVPQELVRISDAVEDGSINQNPALVK
ICQEVRGRQSKLHLVGLCSEGGVHSHLSHLFGLLDLAKAQGISDICIHAIADGRDTKPSE
AVKSIGLIQDYIDRIGVGRIVTISGRYYAMDRDKRWDRVQSAYDVMTQDDESSDSRSAAE
VVKASYAEGKTDEFIIPVRIAPGAVEAGDGIIFFNFRPDRARQLTQAFVKSDFDGFERQQ
IKPLSFVTFTQYEQDLPVEVAFKPQNLNNILGEVISQHGLKQFRTAETEKYAHVTYFFNG
GLEEPLEGEDRELVNSPMVATYDKAPLMSAAAVTDVVLGAIKKGIYSLVVVNYANPDMVG
HTGNMGATVEALEAVDKCLGRLLEGISKAGGTALITADHGNAEYMIDETGNPWTAHTTNP
VPFIVVEGEKAKIAGHATNLKLRTDGKLADIAPSILEILQLPQPQEMTGTSLFKPAEYDV
KVPRSPMNLVMQNN
Download sequence
Identical sequences K9RDK9
gi|427736180|ref|YP_007055724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]