SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Vocar20005489m|PACid:23135383 from Volvox carteri v199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Vocar20005489m|PACid:23135383
Domain Number 1 Region: 203-283
Classification Level Classification E-value
Superfamily SBT domain 6.02e-32
Family SBT domain 0.0000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Vocar20005489m|PACid:23135383
Sequence length 516
Sequence
MAGGAGDDAAAAAAADTVASQNLLASIAGILQNTTAALPPGPPSNAPLGTTPGQGGPGGS
PSQTRTSSNGGSSNANAQGVGLSPGLILLPAGLPFLNAPGLQGLQNLGPYLQLLPGLGPG
GLGAGDGSVPFALPPLGLDGQLNLAALLGATGLELEGQAADLSVLDPTRKTPGVAGSKRP
ADGSAGAPYKRERSEEGRSREGKCHVEGCNADLTGLSSYYQRYRTCEIHLKAPSIMKDGL
QQRFCQQCGRFHELSEFDGNKRSCRSRLQSHNVRRRKRTEEQMANAAAESQAQVGMPPGA
LQAQGLSALTQLPLQPPHGLLGPQQNLTDLLSQAGMESLLNSALAGAAHDPSKQGKPEDA
LTALLNQLPQLPQQLLSGLATPDANQAALLALQTMNNEHLAPPFLDSLLKSATAVVPPGP
VPSDLPPQDLQQQLGLLLAGAPAAAASIVGGDSGGVVDPSGLGAHVGDPSHVHAAAHAHG
DAHHPKPENAALGGATGVHVGPGAGEGHPAEAVAQL
Download sequence
Identical sequences Vocar20005489m|PACid:23135383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]