SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_031458198.1 from Chloroflexus sp. MS-G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_031458198.1
Domain Number 1 Region: 143-243
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 
Domain Number 2 Region: 26-131
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000987
Family Histidine kinase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_031458198.1
Sequence length 249
Comment anti-sigma factor antagonist [Chloroflexus sp. MS-G]
Sequence
MESITLTADLDALAKISAFITAAAERCGLDERATWQVQLAVDEAVTNVIQHAYDPDQPGD
LTLSWQCHDHRFIVTVRDHGRQFDPSTVPVPDITSPLEERQVGGLGIYLITRLMDEVHFE
FSPQGGNLLTMVKYLPHDQPAEANEVVVIAINDRIDALTAPRVSKLVNERISNGARQVVL
DLSNVSFLSSSGLRALLLIRKELMTLGGELRLAALQPQVYEVFTITGFTQVFNIHPSVSE
ARAAFSQRR
Download sequence
Identical sequences WP_031458198.1.42449 2013961767 WP_031458198.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]