SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DPGLEAN11011-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN11011-PA
Domain Number 1 Region: 60-366
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.63e-64
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 971-1196
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.98e-56
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000487
Further Details:      
 
Domain Number 3 Region: 581-799
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.1e-56
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000872
Further Details:      
 
Domain Number 4 Region: 1299-1518
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.64e-50
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1523-1733
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 8.24e-44
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000527
Further Details:      
 
Domain Number 6 Region: 807-989
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.49e-38
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000674
Further Details:      
 
Domain Number 7 Region: 372-585
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.49e-38
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00022
Further Details:      
 
Domain Number 8 Region: 1200-1302
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.09e-23
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN11011-PA
Sequence length 1781
Sequence
MIRKRSHWYLLGFEPAPERRAFSLQATTNSILFHLTTVLATITLSFSSIVKPPSNDGKNF
ELLILHNNDMHARFEQTSQLSGACTTLDREAGKCYGGFPRVATVVKEARRKAASGEGPPV
LYLNAGDTYTGTAWFTIYKWKVAAEFLNALQPDAVSFGSNELEKGSTRLSPFLDNLNSPV
LACNVIVNSMETKQKIQKSIVKDLNGVKVAIVGYLELDSNILDSTGYIEYIDEVIALKDE
ATKLKAQGVKIIVALGHSTPEKDIEIATEVENIDLIISGHRNMFYSNGSNTEMELEQILQ
PVIITQKSGKKIPIFHSFTYDKYLGKIHAVFDSDGNLKAAQSNPILLDKTIKQNVDMSEI
IKKYSDEQTTSLETIIGDTVVVIDGSNCMKEECNLGNLITDSMMFYYATRYEGERWTDAP
IAIINGGSLSGTLSPLIRPFPVRRSDLINFLPGPSNLVTVTMSGTLLQQMLEESVANYTL
NNTSGQFLQFSGIRVIYDISKDPGSRVMSAVIRCWDCDIPEFFELQEERLYKIIIPSTLI
SVSNGYSMLVNLTKENLDYDAVATVTEFIQKRSPVYPEIADRISLGNHEFDNGISGLTPF
VTNLTCPVLAANIILDKVPELRKEENLLRSVVFNINNVKVGVIGYLTPDTKFLAIKNDVE
YIDEVAAIRREVESLKTEGVNILIALGHSGFTKDKDIAYAVDGIDLVIGGHTNTFLWNGL
TSDVEIPEGPYPIYVKQASGKLVPVMQAYAYTKYLGKLLVTFNSDGEIVNVTGNPILLNN
SIPQDPDVLAIVERYQDEVYAISETIAGNSSVYLDGLSCRMSECNMGNLITDAIVNKYAK
EYTGSGWTDSPIAILQGGGIRSSIIHEGQYFNISVGDLYTVMPYDSSIVKITINGSDIVK
MLEHSVASFGKSHGSARLLQMSGMRVVYDLSKSPGKRVKHTEILCGKCNIPIYSNINLTE
NYNILLNGFLSMGGDGYTSLGNHELDHGVSGLTPFIENLTCPVLAANLILNKVPELEKET
NLRKSVVLNKSGVSIGVIGYLTPDTKVLAVKNDVEYIEEVEALQEEVQKLKKEGVNIIIG
LGHSGYLKDLEIAKKVDGLDLIIGGHTNTFLWNGTVPDSEKSLGPYPTYVVQSSGKLVPV
VQAYAYTKYLGKLHMVFNSKGELLSADGRPILLDKTVPQDPEMLSIVDKYKNKVLNYTEE
VIGNTSVLLDGLSCQHKECNMGNLIADAMIYRYVSDYEGREQWSDVPIAVIQGGGIRSSI
DHADFPAPVTKGDLIAVLPFEGTLVVVTMNGKILLQMLEHSSLGNHEFDEEVDGVVPFIA
NLSCPVLAANLILDDVPILEEQSNLHKSVVLTKNGVQIGIIGYLTPDTRFLAPKNDVKYE
EEVNAIRKESLRLRRLGVQIIIALGHSGFLKDLEIAEQVEDLDLVIGGHSNTFLTNTNTS
EIPEYSEGPYPTLVRQKSGRTVLVVQAYAFTKYLGRLHLIFNAQGEIINFDGNPILLNHN
VKQDPIILEIVKRYKLEVNEINSEVVGSSMVFLDGVSCRLKECNLGNFFTDAVVYYTKQH
DNVHSNVNIAVIAGGRIRTSISDNVKPFNITKGDLITVIPFSDSLCIITMNGTILKQALE
HSVASWRLLDAPGQFLQMSGMDVTYDLAKKVGSRVIRARAICSNCKELQVIKEDYEYKII
TSTFLADGGDNYTMFESLPRDVLPYNEVESALYYLSKYSPINTVVSNRIVIFNDDKLKSI
PHRNEDKDKTAQLPSTGHHNKAHTAMFFLLLVMNLSLNGRR
Download sequence
Identical sequences DPGLEAN11011-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]