SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00003573 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00003573
Domain Number 1 Region: 36-353
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.4e-80
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 1163-1471
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.8e-80
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00000674
Further Details:      
 
Domain Number 3 Region: 649-956
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.2e-80
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000118
Further Details:      
 
Domain Number 4 Region: 1476-1687
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 6.54e-50
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00011
Further Details:      
 
Domain Number 5 Region: 356-571
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.22e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000441
Further Details:      
 
Domain Number 6 Region: 964-1135
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.4e-41
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00003573
Sequence length 1723
Sequence
MMSGRSLFIGSCCLLALLIHPVQPNPIVPRADVATEFIILHNNDMHARFEQTSVTSGICS
QEDANTNQCYGGFARVAYEVRKYRKEAQEGGTPVFYLNAGDTYTGTAWFTVYKDKIASAF
LNKLSPDAISLGNHEFDQNVEGLVPFLNAVDFPVLACNLNLTDVPELAAAKQLANSTILE
TNGVKIGVIGYLTPDTKVLAFRNKVEYEEEIVSINAEAEKLKAQGINIIIALGHSGYQKD
QEIAKNCPEVDIVIGGHSHTFLDASQPVADPTDSDPEAVRGPYPTTVVQASGKKVPVVQA
YAYTKYLGKIHVQFDAEGNLIDFDGAPILLNASVTQEQDLLDLLEEYRPKLEELENTVLG
YTKVFLEGGNICRMRECNLGNLVTDAMVYARVVENKGGEFWTDAPIAFMQGGGIRASVDK
QDDGAINGATLLTVLPFENNLYITRVLGKTLLAALEHSAAVRLQDSNGGFLQMSGLRCEY
NYNNEQGKRVVFAQALCSNCSVPTYKSINETEFYKVIVPQFLLEGGDGYDLIEESDPFSE
SLERNDLNATMEYLKQRHFVYPEIEERIVIHEKVDGGSASGIVASISLLLLSSLLTRFFY
FVKTPLGVKLLQRFADEMKSFWLAAIYGILLIHWTQANPILSDPKVATEFIILHNNDMHA
RFEQTSVNSGTCSPEDAHTNKCYGGFARVAYEVRKYRKEAKEGGTSVLYLNAGDTYTGTA
WFTIFKDKIASAFLNKLEPDAISLGNHEFDERVEGLIPFLNEVNFPVLACNLDLSKVPEL
KATKHLAHSAILEANGTKIGVIGYLTPDTKKLTLNMDVEFKEEVESINAEAKGLKAQGIK
IIIALGHSGYSKDQEIAKNCPEVDIVIGGHTNTFLYNGAQPDAEHIDGPYPTMVKQKSGK
EVPVVQAYAYTKYLGKLHVQFDAEGNLIKWDGAPILLNASVAQEQDLLELLEVYRPNVTR
LEKAVVGHSKVHLEGRKEICRAEECNLGNLVTDAFVFSRIMEDQGGDFWTDAAISLMQGG
GIRSSIEKRSDGSITDSDILSVLPWENDLFMVPMSGKSLRRALEHGAGLRGKDSDGGFLQ
VSGIHVVFNLKKPEGQRVVSVQVRCAACRVPTYSDLNDTAIYNVVVGEFLLDGGDVKMLR
LTLQWTFVLLLIPSFPNWISSLKITLLHTNDMHSWYDPISSKGGKCKAGDDERGFCFGGF
ARVAAVINDTRKGGTDSVLYLNGGDSFQGTPWFSVYRGKMVAQMLNFLSPDAMTLGVHEL
DDGTAAFAEFLDIINFPVVSSNINLKGEPKLADHSKLVTSTVITKGKTKIGIVGYIRPDT
KERTQPNNVVYKQEVPAINKETRKLVDQGINIIIALGHSGYEKDKEIARRCPDVDLVVGG
QSHTFLYSGKAPIKEVSEGPYPTIVVKPDGRKVPVVQAYAYTKYLGNLLLEFDNGGNLLS
FKGSPILLDSRFQPRQDVLNFLDQYRQVIDDMERHVVGTTSVYLNGDRRSCGFGECNFGN
FIADSFVYARVLETMPDRRSWTDAPIGLINAGAIRASIEPGETGAITEADVMTALPFSHD
MFYTRISGSQLMKALEHSLQLRSKHVSSSYLQVSGLRMKFNHSRPKGERITEIRALCSAC
QIPHYEAVETDKYYGVVLTSFLLNGGEGYSFIDPKRPEVENLTILDRNAVIRYLQEHKVI
YPEREDRQAPQEKHLSNSSSNLLFEPFLLYLLHYLCVCRRFLG
Download sequence
Identical sequences DS10_00003573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]