SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for DS10_00006913 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00006913
Domain Number 1 Region: 591-820
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.01e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000247
Further Details:      
 
Domain Number 2 Region: 401-577
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.31e-34
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 1-133
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.01e-27
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0001
Further Details:      
 
Domain Number 4 Region: 126-242
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.36e-23
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0016
Further Details:      
 
Domain Number 5 Region: 278-395
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.77e-23
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0016
Further Details:      
 
Weak hits

Sequence:  DS10_00006913
Domain Number - Region: 248-287
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00249
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00006913
Sequence length 822
Sequence
MCPWQNRLVALTLRGKHIVELLEHGVAPMNVSSSSPRSYRFLQVSGLRFAFDLTGPAGQR
VSNVRVRCSKCQVPEYGPLAMEERYRVVVMEYLANGKIGFGVISENAEDLEMGPFDLDTL
MDYMSAAQLLKAQGANIIIVILHCGYDVDQEIAANAGDWIDVIVGSHSPAGDYLTEVIHS
SGHRVLIVQASAYARYVGNLIVYFDDNGDVLDFEGDPLYMDQSVPEDEVVLEAMAPWKVT
VDEMGKVVVGTTKVDHTKDDCAAGECNLGNYFCDDMVHSAQLLKAQGANIIIVILHCGYD
VDQEIAANAGDWIDVIVGSHSPAGDYLTEVIHSSGHRVLIVQASAYARYVGNLIVYFDDN
GDVLDFEGDPLYMDQSVPEDEVVLEAMAPWKVTVDEMGKVVVGTTKVDHTKDDCAAGECN
LGNYFCDDMVHSFVGMAPYEQKAWTNVSAGLMNIGGLRVPLNRGSLTYAHIVSMSPFENT
LVSYNLPGSKIVEAMEWAVSKVDLENGVTGSYINLQFSGIRVKYDYTKPVGSRAGGDGYT
LLAEGTDIQFGVTDLDALISYTEHLDPINQGLDGRITAMVPWQIEMKSYANQIVGESRVY
LQQVECSRGECNLGNFFTDAMLHTFVKDASSSSLENSWSVKDASSSSLEDSWSNVTIALT
SQGTFRVPISAGNITYKQLFAMCPWQNRLVALTLRGKHIVELLEHGVAPMNVSSSSPRSS
RFLQVSGLRFAFDLTGPAGQRVSNVRVRCSKCQVPEYGPLAMEERYRVVVMEYLANGKIG
FGVISENAEDLEMGPFDLDTLMDYMSAVRPIASGIEHRIKKT
Download sequence
Identical sequences DS10_00006913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]