SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410670881|ref|YP_006923252.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410670881|ref|YP_006923252.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Monomethylamine methyltransferase MtmB 1.44e-105
Family Monomethylamine methyltransferase MtmB 0.00000000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410670881|ref|YP_006923252.1|
Sequence length 201
Comment monomethylamine corrinoid methyltransferase [Methanolobus psychrophilus R15]
Sequence
MTFRKSVDCYEFYDRAKKGEKMSQDDWDLMTIPMKSMELKQKYGIDFKGEFVPTDKDMME
KLFKAGFDMLLECGIFCTDTSRVVKYTEDEIWDAINNVQKEFVLGTGRDAVNVRKRKVGD
KRKPIIQGGPTGSPISEDMFMPVHMSYALEKEVDTIVNGVMMTVRGKPTIPKSPYEILAA
KTETRLIKTAAAMAGRPGMGI
Download sequence
Identical sequences K4MEZ0
WP_015053598.1.66729 gi|410670881|ref|YP_006923252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]