SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB0049G10010.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB0049G10010.1
Domain Number 1 Region: 419-825
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-141
Family Reverse transcriptase 0.0000369
Further Details:      
 
Domain Number 2 Region: 302-325
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000262
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB0049G10010.1
Sequence length 998
Comment pep:novel superscaffold:Oryza_brachyantha.v1.4b:JH369876.2:5941:12561:-1 gene:OB0049G10010 transcript:OB0049G10010.1 description:"Uncharacterized protein "
Sequence
MGWKVAKGGAPAPRHCFAAGGYGAAQSKYWDIVKQICTWRLSSLLADGPPRQGLQCNQDA
PPPPGMITLREVMSQQTQLLQMLANNQGGRNNSAYGEFMQAKPPTFAGSEEPMDVEDWLR
IIEKKLALVWAHNGDKEEFVTAFRENFVPAAVIRMKKNDFRRFRQGNMGLQEYLNKFTQL
ARYAPKDLTDEQEKIEKFVEGMNDRLRGAMIGQDHVSFQSLINKVVRLENDQKTVENNRK
RRMAMSRPVQTNVQRPKFTPAPAWKPFPNNTGAIAPYHPATPKAAPIKSSTPIATPFAPG
VKRNLNCFNCGELGHYASSCPKACSTLVHTGANAVTIKDNGTINLGHGLFRTPLNPKPTP
GYPRAQVNHVQAEEAREAPDVLMDQQGSELKVPMDQDPRLHERSHAKAFTMLALEEMPVV
QDYPDVFSEELPGMHPDRDIEFIVELMPGTAPISKRPYRMPANELEGLKNQIRELQEKGF
VRPSSSPWGAPVLFVKKKDGSMQMCVDYHSLNEVRIKNRYPLPRINDLFDQLEGATVFSK
IDLRSGYHQLKIREEDIQKTAFSTRYGLYEFTVMSFGLTNAPAYFMNLMNKVFMEYLDKF
VVYWKDCGEKSITPSSASVNSGLRKSCFRDIISEGGVSVDPEKIDAITAWETPKSVTEVR
SFLGLAGYYRRFIEGFSKIARPLMQLLKKEKKFDWTEQCERSFEKLKDKLTTTPILVLPD
NHKDFVSYCDASRNGLGGVLTQDGKVVAYASRQLRPHEENYPTHDLELAVVVHALKIWRH
YLIGNHCDIYTDHKSLKYIFTQPDLNLRQRRWLELIKDYDLGIHYHPGKANIVADALIVA
QGMVQTLEVQPLLSDQIKLAQGTDSEVIQIKEKMRAGKATDFRVDENGTLWYKRRIFIPY
RNELRQLILKEAHDSAYSLHPGSTKMYQDLKRDYWCSNMKRDVMEYVALCDLCQRAKVEH
QRLAGLLHPLKIPEWKWDEVGMDFITGLPRTTSGYDSI
Download sequence
Identical sequences J3KUE4
OB0049G10010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]