SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB0090G10030.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB0090G10030.1
Domain Number 1 Region: 468-597
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.56e-45
Family Reverse transcriptase 0.0016
Further Details:      
 
Domain Number 2 Region: 291-333
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000129
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Weak hits

Sequence:  OB0090G10030.1
Domain Number - Region: 389-423
Classification Level Classification E-value
Superfamily Acid proteases 0.0394
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB0090G10030.1
Sequence length 597
Comment pep:novel superscaffold:Oryza_brachyantha.v1.4b:super0090:29211:31199:-1 gene:OB0090G10030 transcript:OB0090G10030.1 description:"Uncharacterized protein "
Sequence
MAGGGNGGDIPEGGAQSSSQPPTNQFEGALLNIFQLMETSRKESQESQNKFFQEMLNRMD
PQAREGMTQTRGVSLGEFQQTKPLTFSTSVDPIEAEDWLLDTERKLDTVGCTNDEKVRYA
AHQLKGPAATWWVNFKRMQTAEQPITWELFQQKFKETHVPSSIVELKKKEFRALTQENTS
VLRYVHEFNRLSRYAPDDVDTEAKKREKFLEGLHPFLKMQLRMVRHQQFQELVDGAIALE
NDYREVQEDRRKRARIETRRPPILKNVVRSPVHGRVVPVQRISSKPQSATQEQQFKCYTC
GGAHFQKNCPKLKVNCFNCGQTGHYSTQCPNPKKNTGPQGSNAPGGSRFQRPQARSASGA
QGRGRGFQTARLNYARADQVGASTDVVAEDKIFYADVLVIPLEGIDVILGMDWLAAYGAH
INCEDKTVSLKLNKEGERVLFKGDRSPEITVGLKLNSMKAKSLDQIPIVQEFPDVFPDEL
PGMPLDRDIEFTIDLIPGTSPIALRPYRMGPEELVELRKQLDELESMGYIRESTSPWGAP
VIFVDKKDGGIRMCVDYRALNKVTIKNKYPLPRIDDLFDQLKGAGVFSKIDLRSGYH
Download sequence
Identical sequences J3KUX8
OB0090G10030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]