SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB0152G10010.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB0152G10010.1
Domain Number 1 Region: 360-620
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.78e-105
Family Reverse transcriptase 0.00036
Further Details:      
 
Domain Number 2 Region: 225-254
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000147
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB0152G10010.1
Sequence length 627
Comment pep:novel superscaffold:Oryza_brachyantha.v1.4b:super0152:52:2345:-1 gene:OB0152G10010 transcript:OB0152G10010.1 description:"Uncharacterized protein "
Sequence
MAEVLIAVERNREAQNAVLQQIAASAAAAAAHIARTEQLQDAAGDWWENFLAMQPAGRAI
TWPEFRNAFWAAHVPKGIMDLKQREFLSLTQGNKSVMEYLREFNHLARYAPDDVNTDDRK
QNRFINGLSAEMQLELAAHSFLDFQDLVNRSVVVESKMNNLENERKRKRAAQISAAGGSQ
KPRGWQQPPPRYQAPPPPRRQGFVPRPPQQRVALPVGGNQQAIRPPVRSNNYFNCGQAGH
YINQCPYPRRTQEQGPRAVAPRPNPFPRAAPQGQQNQKRGRVNHVTAEEANNAPDVLVGF
RCHPRHGLAKKNHGVIDCGLRLITLKNNTGEPIFLALDDHPPQLHALSGAKNNDIAAVPV
VCEYPDVFPEELPGMPPDREVEFVIDLLPGTAPISKRPYRMPPNELEELKKQLTELQAKG
FIRPSSSPWGCPALFVKKKDRSLRMCIDYRPLNEVTVKNKYPLPRIDDLFDQLTGAHVFS
KIDLRLGYHQIKIRSEDIPKTAFSTRYGLYEYTVMSFGLTNAPAYFMSLMNLIFMEYLDQ
FVVIFIDDILIYSKSKEEHEKHLRLVLEKLREHRLYAKFSKCEFWLKEVGFLGHVLSEGG
VSIDPTNVQKVLDWGQPKNPIRHLEFS
Download sequence
Identical sequences J3KVD7
OB0152G10010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]