SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392426137|ref|YP_006467131.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392426137|ref|YP_006467131.1|
Domain Number 1 Region: 528-841
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.58e-77
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 40-337
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.42e-65
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0006
Further Details:      
 
Domain Number 3 Region: 337-527
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.49e-52
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000397
Further Details:      
 
Domain Number 4 Region: 844-1057
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.53e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392426137|ref|YP_006467131.1|
Sequence length 1206
Comment 5'-nucleotidase/2',3'-cyclic phosphodiesterase-like hydrolase [Desulfosporosinus acidiphilus SJ4]
Sequence
MLGIKFREAKHKALSFLMLAVMILSVFVSIPQIAIGATAAKTFDFVEVTDFHGTLNPVGS
TQPVAAVLAEQIKTIKAQNPDTVVLSGGDMFQGSALSNILKGQPVINMMTNIGFDAMALG
NHEYDWGIDSVIDSQNAVIKGTSIPVLACNIYSKTTGHPVSYSKPDIMLEKDGVKIGLIG
AVDNLEFPTSITPGLIKDVNFKDPAPIINQLAKDLRNQGAQIVVVVAHMGASQDKNGTVS
GNLIDMVKQLSGVDAVFGGHTHTIVTTKVNNIPVGIGNAYGKGFLDLKVTLNSDGTVSAG
NMIYNDDTVMYKADNPAVDSEVKAIVTKASKDVGPTFNEVVGTASLNLTREQSAMPFGDS
LLGNWSSQAIKDTAQTDFAFMNNGGLRVDLPKGDITVSDVWALMPFDDTIYTMKMTGAQI
KAVLEDAVQDGGLGIQIAGLSFAYDPSKPSMNRVISIKSSGGIPIELSKSYTVATNDFMA
DGGDKFIGFNDPSIVNKQDTGILVRDAFIKEMKTQKTMTASVDHRIQSTAVEVTVLATSD
IHGSILPWDYSSAKEADLGLAKISTYVNQVRSQNPNVVLVDDGDSIQGTPLTYYYDKIDT
KTEYPIAKVMGAMGYDTWTLGNHEYNYGLDVLNRVIGDMQKENINVLSANTYKDDNSNFV
KPYYIKTISTNQGNVNVGIIGLTTKCIPDWEDKAHYSGLHFNDLVEEANKWVPIVRAAGA
DIVVVAAHSGEESPSDTIPENQIKAMATGVNGIDAIVAGHTHKKIDEDTFTNPDGQKVIV
TEPRNAGKDVCQINFTITKDDHGKWQIADKSSKAITIDSKIAADPKILQIAKPYQDETLS
YVATKIGAATGDFLGTNQLSQETPLMDLINKVQKHYAKTDLSIAAPLSNKAKILKGDVTI
QDLMGVYVYENYLYGIKMTGKQLKNWMEWSARYYKQAASPSDPVTKDTALNVPDYNLDQL
YGATYTIDLTQPIGSRIKNLKVNGKLVQDNDVFTVAINNYRYNGGGGFMDKAGISNPEVT
FDSAKQYGDDGQVRNLMIKYIQEKGTIEPTIDNDWTISMNPVINGTGSAVPAPSTTDANK
LQVTASWLNLRTGPGLDYSVVGSIPHGTLVELVSTSGDWDKISYQGNTYFINAKFVKPRS
QVLKTVKVISQIGLNVRDGAALSGKILGALPYGSLVEVVGASGDWYKIIYKNGYGYIYAQ
FTAQLS
Download sequence
Identical sequences I4D7M5
WP_014827792.1.101568 gi|392426137|ref|YP_006467131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]