SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384517161|ref|YP_005704466.1| from Enterococcus faecalis 62

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384517161|ref|YP_005704466.1|
Domain Number 1 Region: 105-418
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.58e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 685-963
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.09e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 974-1192
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.84e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000479
Further Details:      
 
Domain Number 4 Region: 418-632
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-41
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384517161|ref|YP_005704466.1|
Sequence length 1321
Comment LPXTG-motif cell wall anchor domain-containing protein [Enterococcus faecalis 62]
Sequence
MKKLSFKKVKWGMHFLMAVALIAPSVTSTAYAVETTSQQSSEAVTSTTDSSRKQEPVITQ
ETTDIKQEAPNQATSDSVKQSQETTAPTETTNLETSTAEKEETSTPQKITILGTSDVHGQ
LWNWSYEDDKELPVGLSQVSTVVNQVRAQNPAGTVLIDNGDNIQGTILTDDLYNKAPLVN
EKTHPMITAMNVMKYDAMVLGNHEFNFGLPLIQKIQQEATFPILSANTYNKEDGRRFVKG
TTTKELDFNQDGQPDLKVGIIGLTIPHIPLWDGPRVTSLNFLPLKEEAEKAVTELKTNDQ
ADIIVASIHAGQQNSDPAASADQVIENVAGIDAYILGHDHLSFTKQGAAPNGKTVPVGGP
KDTGTEVVKIDLSVAKNADKWEVQEGTATIVPTTNVPADEAVKAATKEYHEKTRAFIQEE
IGTATADFLPKQEIKGIPEAQLQPTAMISLINNVQKEVTGAQLSAAALFKYDSKLPAGKI
SYATIFDIYKYPNTLVSVPINGENLLKYLEKQGAYYNQTQPDDLTISFNPNIRVYNYDMI
SGVDYKIDISKPVGERIVDAKIDGQPLDPAKEYTIAMNNYRYGGLASQGIQVGEPIKNSD
PETLRGMIVDYIKKKGTLDPEQEIERNWSIIGTNFDEKWRAKAIELVNDGTLQIPTSPDG
RTPNAAAITKQDVRNAGFDLDNAYTIMHTNDVHGRLEAGKGELGMARLKTFKDQENPTLM
VDAGDVFQGLPISNFSKGADMAKAMNEVGYDAMAVGNHEFDFGLEIALGYKDQLNFPILS
SNTYYKDGSGRVFDPYTIVEKAGKKFAIVGVTTPETATKTHPKNVEKVTFKDPIPEVEAV
INEIKEKYADIQAFVVTGHLGVDETTPHIWRGDTLAETLSQTYPELDINVIDGHSHTAVE
SGKRYGKVIYAQTGNYLNNVGIVTAPENEPTKKTAKLIPAEELLGLPENPAVKAIVDEAR
TNFNAENEKVIVDYIPFTLDGQRENVRTRETNLGNLIGDAIMSYGQDAFSQPADFAVTNG
GGIRADIKQGPIKVGDVIAVLPFGNSIAQIQVTGAQVKEMFEMSVRSIPQKDENGTILLD
DAGQPKLGANGGFLHVSSSIRIHYDSTKPGTRLASDEGNETGQTIVGSRVLGIEIKNRQT
QKFEPLDEKKQYRMATNDFLAAGGDGYDMLGGEREEGISLDSVLIEYLKSATSLRLYRAA
TTIDLAQYKEPFPGERIVSISEEAYKELIGGGETPKPDPKPDPKPDPKPDPKPTPETPVA
TNKQNQAGARQSNPSVTEKKKYGGFLPKTGTETETLALYGLLFVGLSSSGWYIYKRRNKA
S
Download sequence
Identical sequences A0A0M2CPV8
WP_002392572.1.12145 WP_002392572.1.24581 WP_002392572.1.28817 WP_002392572.1.40357 WP_002392572.1.52614 WP_002392572.1.67716 WP_002392572.1.69290 WP_002392572.1.83953 WP_002392572.1.91813 gi|384517161|ref|YP_005704466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]