SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397698642|ref|YP_006536430.1| from Enterococcus faecalis D32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397698642|ref|YP_006536430.1|
Domain Number 1 Region: 191-469
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.31e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 480-698
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.79e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000488
Further Details:      
 
Domain Number 3 Region: 37-138
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.16e-22
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397698642|ref|YP_006536430.1|
Sequence length 817
Comment LPXTG-motif protein cell wall anchor domain protein [Enterococcus faecalis D32]
Sequence
MPFYFSNLILQFAYLEKQGAYYNQTQPDDLTISFNPNIRVYNYDMISGVDYKIDISKPVG
ERIVDAKIDGQPLDPAKEYTIAMNNYRYGGLASQGIQVGEPIKNSDPETLRGMIVDYIKK
KGTLDPEQEIERNWSIIGTNFDEKWRAKAIELVNDGTLQIPTSPDGRTPNAAAITKQDVR
NAGFDLDNAYTIMHTNDVHGRLEAGKGELGMARLKTFKDQENPTLMVDAGDVFQGLPISN
FSKGADMAKAMNEVGYDAMAVGNHEFDFGLEIALGYKDQLNFPILSSNTYYKDGSGRVFD
PYTIVEKAGKKFAIVGVTTPETATKTHPKNVEKVTFKDPIPEVEAVINEIKEKYADIQAF
VVTGHLGVDETTPHIWRGDTLAETLSQTYPELDITVIDGHSHTAVESGKRYGKVIYAQTG
NYLNNVGIVTAPESEPTKKTAKLISAAELLELPENPAVKAIVDEARTNFNAENEKVIVDY
IPFTLDGQRENVRTRETNLGNLIGDAIMSYGQDAFSQPADFAVTNGGGIRADIKQGPIKV
GDVIAVLPFGNSIAQIQVTGAQVKEMFEMSVRSIPQKDENGTILLDDAGQPKLGANGGFL
HVSSSIRIHYDSTKPGTRLASDEGNETGQTIVGSRVLGIEIKNRQTQKFEPLDEKKQYRM
ATNDFLAAGGDGYDMLGGEREEGISLDAVLIEYLKSATSLRLYRAATTIDLAQYKEPFPG
ERIVSISEEAYKELIGGGETPTPDPKPDPTPETPVATNKQNQAGARQSNPSVTEKKKYGG
FLPKTGTETETLALYGLLFVGLSSSGWYIYKRRNKAS
Download sequence
Identical sequences gi|397698642|ref|YP_006536430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]