SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384512020|ref|YP_005707113.1| from Enterococcus faecalis OG1RF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384512020|ref|YP_005707113.1|
Domain Number 1 Region: 685-963
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.54e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 105-418
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.32e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 974-1192
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 8.76e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000488
Further Details:      
 
Domain Number 4 Region: 418-632
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-41
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384512020|ref|YP_005707113.1|
Sequence length 1329
Comment 5'-nucleotidase [Enterococcus faecalis OG1RF]
Sequence
MKKLSFKKVKWGMHFLMAVALIAPSVTSTAYAVETTSQQSSEAVTSTTDSSRKQEPVITQ
ETTDIKQEAPNQATSDSVKQSQETTAPTETTNLETSTAEKEETSTPQKITILGTSDVHGQ
LWNWSYEDDKELPVGLSQVSTVVNQVRAQNPAGTVLIDNGDNIQGTILTDDLYNKAPLVN
EKTHPMITAMNVMKYDAMVLGNHEFNFGLPLIKKIQQEATFPILSANTYNKEDGLRFVEG
TTTKELDFNQDGQPDLKVGIIGLTIPHIPLWDGPRVTSLNFLPLKEEAEKAVTELKTNDQ
ADIIVASIHAGQQNSDPAASADQVIENVAGIDAYILGHDHLSFTKQGAAPNGKTVPVGGP
KDTGTEVVKIDLSVAKNADKWEVQEGTATIVPTTNVPADEAVKAATKEYHEQTRAFIQEE
IGTATADFLPKQEIKGIPEAQLQPTAMISLINNVQKEVTGAQLSAAALFKYDSKLPAGKI
SYATIFDIYKYPNTLVSVPINGENLLKYLEKQGAYYNQTQPDDLTVSFNPNIRVYNYDMI
SGVDYKIDISKPVGERIVDAKIDGQPLDPAKEYTIAMNNYRYGGLASQGIQVGEPIKNSD
PETLRGMIVDYIKKKGTLDPEQEIERNWSIIGTNFDEKWRAKAIELVNDGTLQIPTSPDG
RTPNAAAITKQDVRNAGFDLDNAYTIMHTNDVHGRLEAGKGELGMARLKTFKDQENPTLM
VDAGDVFQGLPISNFSKGADMAKAMNEVGYDAMAVGNHEFDFGLEIALGYKDQLNFPILS
SNTYYKDGSGRVFDPYTIVEKAGKKFAIVGVTTPETATKTHPKNVEKVTFKDPIPEVEAV
INEIKEKYADIQAFVVTGHLGVDETTPHIWRGDTLAETLSQTYPELDITVIDGHSHTAVE
SGKRYGKVIYAQTGNYLNNVGIVTAPENEPTKKTAKLIPAEELLGLPENPAVKAIVDEAR
TNFNAENEKVIVDYIPFTLDGQRENVRTRETNLGNLIGDAIMSYGQDAFSQPADFAVTNG
GGIRADIKQGPIKVGDVIAVLPFGNSIAQIQVTGAQVKEMFEMSVRSIPQKDENGTILLD
DAGQPKLGANGGFLHVSSSIRIHYDSTKPGTRLASDEGNETGQTIVGSRVLGIEIKNRQT
QKFEPLDEKKQYRMATNDFLAAGGDGYDMLGGEREEGISLDAVLIEYLKSATSLRLYRAA
TTIDLAQYKEPFPGERIVSISEEAYKELIGGGETPKPDPKPDPKPDPKPDPKPDPKPDPK
PTPETPVATNKQNQAGARQSNPSVTEKKKYGGFLPKTGTETETLALYGLLFVGLSSSGWY
IYKRRNKAS
Download sequence
Identical sequences A0A2G9QNW2
WP_002413971.1.101914 WP_002413971.1.61089 WP_002413971.1.6626 gi|384512020|ref|YP_005707113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]