SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC34509 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC34509
Domain Number 1 Region: 7-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.84e-57
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 570-747
Classification Level Classification E-value
Superfamily PH domain-like 9.02e-36
Family Phosphotyrosine-binding domain (PTB) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC34509
Sequence length 782
Comment pep supercontig:GCA_001187945.1:JRES01000062:1509716:1518286:-1 gene:FF38_02774 transcript:KNC34509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKCQDLLEAARNGNTTVVNKILQHKGGPLSSFRRSPSINWQDVNGYTALHHACLNGHYE
IVKVLLAHHAAHEIPDIRGSSPLYLAAWAGNEHIVNLLLMLRGTGNLNAQTIENETALHC
AAQHGHNAVVSALLARGADPTIRNNSFQTPLDLAAQFGRLEVVQTLISKHPELIEPYRLY
DEVVAVENGCSPPYKITPTKHIFTQSCLHLAARNGHNEVVKTLLAAGVDVNILTHTGSAL
HEAALCGKKNVVCTLLSAGIDLYAVDGNGKTALDILKDYPTNVTYEILTIINDFWQKNSS
MINKNHFRPIKDVNDNHATMSASTSQEMDINQIPDFEHQHQRSLTINRISLRSGSFDSNN
NNDIQTPHEHSPTPDCPPPSASEAESTIFEFVKPAERTLKRKSLLLHQQDSQFYDGLKSF
IWEDHTEPQEEQFDSLTSSRVSECVEEFVGDVPFAGLFKGSSLNLANTSSSLDLRNSVVI
DEIPSGLRSPSLVRSVKPIPAKRNVTIKTPTSEDEYEFDATKAWDEINTIFESIGNEVAA
TDTKLEDLSEKNAITNTLRKKTLTMRKPADLLLGSNTQEQNTNPNWCHSANTLIYGYVIY
NVFYLGSTVIRELHGTASTRKSIQKLKREETPAPQEDNEENVLIKDINSSTRILKATNQQ
TRLEVGIAMSHAGVRFIEMENKSTICVHDIENINCVSQDTDDLRYFAYITRENNIHYCHV
FMVDDLNLATEIILTLGQAFEVAYQLSLISQEDSLRTQTQCSTPLEMNGEKRLSYVDVVD
NI
Download sequence
Identical sequences A0A0L0CSX4
KNC34509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]