SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|390933234|ref|YP_006390739.1| from Thermoanaerobacterium saccharolyticum JW/SL-YS485

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390933234|ref|YP_006390739.1|
Domain Number 1 Region: 537-852
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.63e-85
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 34-338
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.42e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00067
Further Details:      
 
Domain Number 3 Region: 341-531
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.19e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000524
Further Details:      
 
Domain Number 4 Region: 853-1068
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.14e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|390933234|ref|YP_006390739.1|
Domain Number - Region: 1104-1140
Classification Level Classification E-value
Superfamily SH3-domain 0.0003
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390933234|ref|YP_006390739.1|
Sequence length 1208
Comment 5'-nucleotidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
Sequence
MFKGRGKVLSIILTFVMVFGMAFSSMPQISYAATSKTFDFVEVTDFHGYLQASGKLSDGT
PITQERGSVLAKRIKDIKAANPDTVVLSGGDMFQGTPLSNVLKGQPVIDMMKSIGFDAMA
LGNHEYDWGINSVIDTSSAVLKGSTIPVLAANVYDKTTGKPVSYTKPCVVIERDGVKIGI
IGIVDNKEFPSIILPSLISNVDFKDPVPIVNNLAQQLRNDGAQIVVVLAHMGATTDKNTG
ETTGNLIDFAKSVKGVDAIFGGHTHTIVTTRVNGIPVGVANNAGMGFIDLKITVNSDGTV
NTGDMVYNDDYSYYNTKTPIVDEDVQSIVDKAIQDAGPLFSQVIGTADVDLTRTQSANPF
GDSILGNWTSEVVKDAVNADFAFGNNGGLRTDVLKGDITVGTMYTLMPFDNTIVTVSMTG
AEIKKVLEQAVQDGGKGIQVAGLSFKYDPNKPSMNRVFDMKKSDGTPIDMNARYLVATNN
FMGTGGDGFTEFTDPDVQKSYIDTQKLVRDAFIDAVKAQGHITAKIDNRISPATMIASNE
TTITVLATSDVHGNLVPWDYSSAKEANQGLAKVAGYVDKVRSENPNVVLVDNGDTIQGTP
LSYYYDKIDTKSEYPMAKAMGAMHYDTWTLGNHEFNYGLDVLDRVIADMEKENIHVLSAN
TYKDDGTNFVEPYYIKTITTPMGDVKVGILGLTTKEIPSWEDKAHYAGLKFNDLVEEANK
WVPKVRAAGADIVVVAMHSGEESPSDTIPENQVKAVAQGVNGIDAIIAGHTHAVIQMDTF
KNPEGKDVIVTEPGKWGQYVSRIDFNLSKDENGKWVIDSKTSKAVAMDSSVQPDENIMQL
AEPYQEATLKYVGTKIGTASGDFLGKDQLTKETALMDLINKVQKYYAKTDLSIAAPLSST
AQILKGDVTIQDMMSVYVYENYLYGIKMTGKQLKDWMEWSARYYQQVKSPDDPITKDKTL
NIPDYNLDQLYGASYTIDLTQPVGNRIKNLTVNGKPVKDDDVFTVAINNYRFNGGGGFMK
AAGITNPVVVFDSAKAYGDDGQVRNLMISYIKMKGTIDPVVDNYWTISKTPVSEGNIASK
GIVTASALNVRLGAGTNYKVIGILRAGQSIDIVGENNGWYKIDYNGKTGYVYSKYVASSP
DLSNVSVLKVVKVTAKDGLNVRVNNSINALKIGAIPYGYELKVVGEYDGWYKVQYNGAYG
FVYAKYTK
Download sequence
Identical sequences I3VRJ5 W9EIJ9
WP_014757064.1.3173 gi|390933234|ref|YP_006390739.1| gi|390933234|ref|YP_006390739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]