SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_4DL_614C6B143.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4DL_614C6B143.1
Domain Number 1 Region: 102-159
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.000000000051
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 30-103
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000000034
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_4DL_614C6B143.1
Sequence length 160
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4DL_scaff_14302325:3610:7835:1 gene:Traes_4DL_614C6B143 transcript:Traes_4DL_614C6B143.1 description:""
Sequence
MMARRPGAGEERPWKLAEHARLGKGKVVGVVVLDGWGEAPPDPFNCIHVADTPTLDALKK
GAPERWRLIKAHGTAVGLPTDDDMGNSEVGHNALGAGQIYAQGAKLVDLALASGKIYEGE
GFKYIQQSFETGTLHLIGLLSDGGVHSRIDQLQLLLKGAS
Download sequence
Identical sequences Traes_4DL_614C6B143.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]