SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428765739|ref|YP_007151850.1| from Enterococcus faecalis str. Symbioflor 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428765739|ref|YP_007151850.1|
Domain Number 1 Region: 684-962
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.99e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 105-417
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.36e-65
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00024
Further Details:      
 
Domain Number 3 Region: 973-1191
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 8.63e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000488
Further Details:      
 
Domain Number 4 Region: 417-631
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-41
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428765739|ref|YP_007151850.1|
Sequence length 1316
Comment 5-nucleotidase family protein [Enterococcus faecalis str. Symbioflor 1]
Sequence
MKKLSFKKVKWGMHFLMAVALIAPSVTSTAYAVETTSQQSSEAVTSTTDSSRKQEPIITQ
ETTDIKQEAPNQATSDSVKQSQETTAPTETTNLETSTAEKEETSTPQKITILGTSDVHGQ
LWNWSYEDDKELPVGLSQVSTVVNQVRAQNPAGTVLIDNGDNIQGTILTDDLYNKAPLVN
EKTHPMITAMNVMKYDAMVLGNHEFNFGLPLIQKIQKEATFPILSANTYNKDGSRFVEGT
TTKELDLNQDGQPDLKVGIIGLTIPHIPLWDGPRVTSLNFLPLKEEAEKAVTELKTNDQA
DIIVASIHAGQQNSDLAASADQVIENVAGIDAYILGHDHLSFTKQGAAPNGKTVPVGGPK
DTGTEVVKIDLSVAKNADKWEVQEGTATIVPTTNVPADEAVKAATKEYHEKTRAFIQEEI
GTATADFLPKQEIKGIPEAQLQPTAMISLINNVQKEVTGAQLSAAALFKYDSKLPAGKIS
YATIFDIYKYPNTLVSVPINGENLLKYLEKQGAYYNQTQPDDLTVSFNPNIRVYNYDMIS
GVDYKIDISKPVGERIVDAKIDGQPLDPAKEYTIAMNNYRYGGLASQGIQVGEPIKNSDP
ETLRGMIVDYIKKKGTLDPEQEIERNWSIIGTNFDEKWRAKAIELVNDGTLQIPTSPDGR
TPNAAAITKQDVRNAGFDLDNAYTIMHTNDVHGRLEAGKGELGMARLKTFKDQENPTLMV
DAGDVFQGLPISNFSKGADMAKAMNEVGYDAMAVGNHEFDFGLEIALGYKDQLNFPILSS
NTYYKDGSGRVFDPYTIVEKAGKKFAIVGVTTPETATKTHPKNVEKVTFKDPIPEVEAVI
NEIKEKYADIQAFVVTGHLGVDETTPHIWRGDTLAETLSQTYPELDINVIDGHSHTAVES
GKRYGKVIYAQTGNYLNNVGIVTAPESEPTKKTAKLISAAELLELPENPAVKAIVDEART
NFNAENEKVIVDYIPFTLDGQRENVRTRETNLGNLIGDAIMSYGQDAFSQPADFAVTNGG
GIRADIKQGPIKVGDVIAVLPFGNSIAQIQVTGAQVKEMFEMSVRSIPQKDENGTILLDD
AGQPKLGANGGFLHVSSSIRIHYDSTKPGTRLASDEGNETGQTIVGSRVLGIEIKNRQTQ
KFEPLDEKKQYRMATNDFLAAGGDGYDMLGGEREEGISLDAVLIEYLKSATSLRLYRAAT
TIDLAQYKEPFPGERIVSISEEAYKELIGGGETPKPDPKPDPKPDPKPTPETPVATNKQN
QAGARQSNPSVTEKKKYGGFLPKTGTETETLALYGLLFVGLSSSGWYIYKRRNKAS
Download sequence
Identical sequences WP_010709081.1.19734 WP_010709081.1.25979 WP_010709081.1.37850 WP_010709081.1.59645 WP_010709081.1.61180 WP_010709081.1.87482 WP_010709081.1.89321 WP_010709081.1.91608 gi|428765739|ref|YP_007151850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]