SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336476280|ref|YP_004615421.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476280|ref|YP_004615421.1|
Domain Number 1 Region: 13-451
Classification Level Classification E-value
Superfamily Monomethylamine methyltransferase MtmB 3.27e-82
Family Monomethylamine methyltransferase MtmB 0.000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336476280|ref|YP_004615421.1|
Sequence length 453
Comment Monomethylamine methyltransferase MtmB [Methanosalsum zhilinae DSM 4017]
Sequence
MSDIYRYLRSSFDGEEKKETKHDMDVFRNCEELASDYGIEYDEASFVPYDMNMVDSVFSA
AIELLTDVGIYCTDTGRSIKIDEEDILKSLGTPKNLEIGSFREKIDVIGRSPMDPQPPVI
IGGPMGGTVSEKNFLNLHISSAIEPIIQGIYAGALESVNYGPIKAKSPEEMFATLEEARL
ERLATKISGREGLALFGPGTPTISQAYMLVSSNELYSRNDVQEVYQLDELKTDFETFYKS
IFHQEHGNNFLSGQCPVFGGTCIGSAEGLAIVDVAETIQSRLVTGASLHASGAVHMNTNS
SSAKEILWASNISSLAISRNMSHPTARYYWNLAGCCTDMMFYETAAQAIGDTVCGREMLI
GPVGGRGARADQSTGLESRFMGEISRIALNMDLAEADEIIGMIYSKYEERLSNAPEGKPF
DSCYIVNSGYDMRPTDEYMELYSEIITEIEEYY
Download sequence
Identical sequences F7XP08
gi|336476280|ref|YP_004615421.1| WP_013897641.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]