SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297543865|ref|YP_003676167.1| from Thermoanaerobacter mathranii subsp. mathranii str. A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297543865|ref|YP_003676167.1|
Domain Number 1 Region: 540-849
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.59e-78
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 33-341
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.04e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0007
Further Details:      
 
Domain Number 3 Region: 340-530
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.4e-53
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000497
Further Details:      
 
Domain Number 4 Region: 850-1064
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.35e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|297543865|ref|YP_003676167.1|
Domain Number - Region: 1118-1156
Classification Level Classification E-value
Superfamily SH3-domain 0.00057
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297543865|ref|YP_003676167.1|
Sequence length 1222
Comment 5'-nucleotidase domain-containing protein [Thermoanaerobacter mathranii subsp. mathranii str. A3]
Sequence
MFRSRSGILAILVAAIMVLSMFFSAIPQIAFAATSKTFDFIEVTDFHGYLQNDGKLSDGT
IYKQQIAGVLAKQIKDIKAQNPDRTVILSGGDMFQGTSLSNVLKGQPVIDMMKNIGFDAI
TLGNHEYDWGIDSVIDTQNATLKNSTIPVLGANVYDKTTGKPVSYTKPYVIIERDGVKIG
IIGIVDNKEFPNIIMPAYIQNVEFKDPVPIVNDLAQQLRQQGAQIVVVLAHMGAYQDKSG
NATGNLIDFAKQVKGVDAIFGGHTHTIVTTRVNGIPVGVAANYGKGFINLKITLNDDGTV
TTGDMQYIDITGLYSTQNPAVDPEVQAIVDKSSEDVGPIFNEVIGQAAIDLTRTQSAEPY
GDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDITVGMMYQLMPFDNTIVTMKMTG
AQIKTILEQAVQDGGKGIQVAGLSFKYDPTKPSMHRVFDMKKSDGTPVVMDKTYLVATNN
FMGTGGDGFKGFTDPDVAKTYVDTYKLVRDAFIEAVKAQKVVTSTIDNRIAPGTNNSILV
TVLATSDMHGNIFPWDYNNAKAANRGLAKVATYIKQVRTQYPYVVLVDNGDTIQGTPLSY
YYNKIDTETEYPLAKVMGAMKYDTWTLGNHEYNYGLDVLNRVIKDMRSEGIHVLSANTYK
DDGTNFVDPYYIKTFDTPEGPVKVGILGLTTKTIPSWEDKDHYAGLYFNDHVEEANKWVS
KLREAGADIVVVTMHSGEEKPTDTIPENQVIAVATQVNGIDAIVAGHTHANIPQHTYTNP
AGNTVIITQPGKWGEYVSQIYFDIVKNAEGKWVVGDKWSTTVKMDDSIQADPDIIKLAQP
YQDATLKYIGTKIGIAAGDFLGTEQTVKETAIMDLINKVQKYYAKTDLSIAAPLSSSAKI
LKGDITIQDIMGVYVYENYLYGIKMTGKQLKDWMEWSARYYKQVSSPNDPITKDPTLNIP
DYNLDQLYGASYVIDLTQPAGHRIKNLKVNGKLVKDDEVFTVAINNYRFNGGGGFMQAAG
ITNPEIVFDSAKAYGDDGQVRNLMIRYIQEHGTITPTVENYWYVSTTPVVEETPVPQPQP
TPQPQPVPQPVYNYGIVTASALNVRAGANTSSKIIGVLPAGKVVTLLEKVNGWYKIDYNG
KTGYLYGKYVAATPNPSNVTVLKAVKVTAKSGLNVRVGNSITAKKIGAVPYGTELKVVGE
YNGWYQIEYNGGFGYVYAKYTK
Download sequence
Identical sequences D7AS12
WP_013149766.1.86608 gi|297543865|ref|YP_003676167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]