SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296140965|ref|YP_003648208.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296140965|ref|YP_003648208.1|
Domain Number 1 Region: 113-335
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.56e-53
Family Prokaryotic proteases 0.00000158
Further Details:      
 
Domain Number 2 Region: 312-401
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000106
Family HtrA-like serine proteases 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|296140965|ref|YP_003648208.1|
Domain Number - Region: 6-58
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00105
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296140965|ref|YP_003648208.1|
Sequence length 420
Comment peptidase S1 and S6 chymotrypsin/Hap [Tsukamurella paurometabola DSM 20162]
Sequence
MTEGPQNPYQPGNPPGGQSGYPGQQPGQPSVPGQPPTYRPTQQLPGYGPAQPGGPVAVAP
NRAPSRPGVGALTAIGVAIALVASLLSVTGAYLVWGGDSSKASSPVSNSAPAPKGSVQEV
AQTVLPSVVSIDNRAATSESSGSGVVISADGKIVTNNHVIAGNGALTVTFSDGSTSSADL
VGADPVTDLAVIRVRKGGLKPITFGDSGKLAVGQDVVAVGAPLGLAGTVTSGIVSALNRP
VATSGRDSDQATVVNSVQTDAAINPGNSGGALVDMQGQLVGVNSAIASLGSSRAGGQQSG
SIGLGFAIPSDLVKRITNELITTGQATHAAVGVQVSPGQTSAAEPGAVIGAVSPTGAFGR
AGIPEGSRVTKIDSLQISDGIGLMGAVRSYSPGATVTITYVAPGSSSAATKQVTLDKLDR
Download sequence
Identical sequences D5UVT7
gi|296140965|ref|YP_003648208.1| WP_013127869.1.58240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]