SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78043585|ref|YP_361282.1| from Carboxydothermus hydrogenoformans Z-2901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78043585|ref|YP_361282.1|
Domain Number 1 Region: 531-845
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.16e-83
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 33-340
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.53e-77
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 341-528
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.4e-54
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000441
Further Details:      
 
Domain Number 4 Region: 847-1063
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.76e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78043585|ref|YP_361282.1|
Sequence length 1215
Comment 5'-nucleotidase [Carboxydothermus hydrogenoformans Z-2901]
Sequence
MLKLQKLRFLATVLVLALIFSFVNPGLAAIFASTPKTVDLLEVTDFHGYLKYDTTLNGQP
LEQKIAAVLAKKLKDIKASNPNTVILSGGDMFQGTPISNVLRGKPVVEFMNNVGFDAMTL
GNHEFDWGLDAVIDYNTNTIKGAKFPLLAANIVYKADNTRPPFFKPYTIIDKNGIKIGVI
GLVSTDFPNVIMPAYIAPFKILDPVTTANALIPEVKAAGANIVVILAHMGAFDSTLTKTD
IPDNELINLAKNINGADVIFGGHTHTIIAGKVNGIPVAVAQNNGKGFARVTLTLDENNKI
VDSTVSFVSIVNDYNTQTPVIDPEVNAIVEAAKAEVGPMFSEVIGRAAFDLTRTQSASPF
GDSLLGNWAADVTRKKVGAQIGFANNGGLRTDLKAGNITVGDIFTLMPFDNTIYKLQMKG
STIKKVLEQAVMDGGKGIQVAGLKFEYLPTLPSMSRVTKVTLEDGTPLDDNAVYTVATNN
FMATGGDNFTAFKEAVSAEDTFILVRDAFIEDIRSKGTITSQIDNRIKPATDIYKISILA
TSDLHGNIFPLDYYQNIPYDQGLAKVYTYVKQVRAQNPVILVDNGDTIQGTPLNYYFNMI
DTESEYPMMKAMGYMGYDAWTLGNHEFNFGLNTLNRIILDATNEGIAVLSANIVWAKDGR
TYVRPYIIKPVNTPFGTVKVGILGLTTKTIPSWENPANYKGLEFKDPIETAKYWIPRMKA
QGADYIIVTFHSGEESATDVIPENQVKALATSVDGINAIVAGHTHRNIGMNIYTSPSGNR
VIVTQPDRWGRYVSHIDLIFVKDSNGNYKFAGTTSKTVKMDANYPADQELLAVMQPYQDK
VLAYTGTKIGTAAGDFLATGITTQDTALMDLVNEVQRYYAKADLSIAAPLSTTAKIYKGD
ITIQDIMSLYIYENFLYGIKMTGKQLKDWLEWSARYYKQVTSPTDPVVKDPVYNIPDYNL
DMLHGATYTIDLTAPVGQRIKNLKVNGKLVKDTDVFKVAINNYRFNGGGGFMAAAGISNT
DPSIVYFDSAKEMGDDGQIRSLIIRYIQEKGTIVPKVDNNWRISTTPVEQEKDVEIKPTP
NPAPAPQYAVVINLRAYVKANPSASAPTVAVVSGGSRYQIVVKDGSWYKVKVGSIFGYIN
AKDVLVTTQPEKIVVYKKVKVTSKSGAYIRDKAVDGKVIATVRYGTTLEVIGFAGNRYKV
KYGNKTGYIWEKLVS
Download sequence
Identical sequences Q3A9A2
WP_011345355.1.931 gi|78043585|ref|YP_361282.1| 246194.CHY_2488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]