SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302392469|ref|YP_003828289.1| from Acetohalobium arabaticum DSM 5501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302392469|ref|YP_003828289.1|
Domain Number 1 Region: 3-457
Classification Level Classification E-value
Superfamily Monomethylamine methyltransferase MtmB 3.66e-163
Family Monomethylamine methyltransferase MtmB 0.0000000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302392469|ref|YP_003828289.1|
Sequence length 462
Comment monomethylamine:corrinoid methyltransferase [Acetohalobium arabaticum DSM 5501]
Sequence
MTTKKKVDVFEAYNRALTGPKVDKDEWDYEVIPENAKKMKEKYDIEFEEGEFIPTDEDLI
DRLFQAGLEMLVETGAYCKETGRVIEYTEEEVLEAIKAAPKSVTLGEGKDAVELVSRTHK
DTEPPIIQGGPTGAPVSEDLFVEMHEAFAQEPLVDTIVNGVFETINGNQPAPGSPWEIKA
SKSEGKLIRHACKRAGYPGTGLOGCETALSPAGCIAADHDGGMKESDSHEVSQLNELKID
VGALTFTAHYVLNGDVIMCEQMPIFGGYAGGLEETTIVDVATHLNSFLMTDADYHLDGPV
HVRWGITTARETLQVAGHCARAIAANTDLITSNQYYTLAGPCTEMCLLETAAQSITDTAS
GRGLLSGVASAKGVETDYTTGMEARFMGEAAYSVAGMELNKVNKILDELVATYENNYNDA
PKGKKFQECYDVVTLDPNDEYLEVYEKAAKTLKEIGLDIKDY
Download sequence
Identical sequences D9QRT3
gi|302392469|ref|YP_003828289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]