SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304317752|ref|YP_003852897.1| from Thermoanaerobacterium thermosaccharolyticum DSM 571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304317752|ref|YP_003852897.1|
Domain Number 1 Region: 536-852
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.43e-85
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 34-339
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.11e-69
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00067
Further Details:      
 
Domain Number 3 Region: 341-531
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.75e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000505
Further Details:      
 
Domain Number 4 Region: 853-1068
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.09e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|304317752|ref|YP_003852897.1|
Domain Number - Region: 1104-1140
Classification Level Classification E-value
Superfamily SH3-domain 0.00285
Family SH3-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304317752|ref|YP_003852897.1|
Sequence length 1208
Comment 5'-nucleotidase domain-containing protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
Sequence
MFKGRGKVLSIILTFVMVFGMVFSSMPQISYAAASKTFDFVEVTDFHGYLQASGKLSDGT
PITQERGSVLAKRIKDIKAANPDTVILSGGDMFQGTPLSNVLKGQPVIDMMKSIGFDAMA
LGNHEYDWGVDSVIDTSNAVLKGSTIPVLAANVYDKTTGKPVSYTKPYVVIERDGVKIGV
IGIVDNKEFPSIILPSLISNVDFKDPVPIVNNLAQQLRNDGAQIVVVLAHMGATTDKNTG
ETTGNLIDFAKSVKGVDAIFGGHTHTIVTTRVNGIPVGVANNAGMGFIDLKITVNGDGTV
SASDMVYNDDYSYYNMKTPIIDEDVQSIVDKAIQEAGPLFSQVIGTADVDLTRTQSANPF
GDSILGNWTSEVVKDAVNADFAFGNNGGLRTDVLKGDITVGTMYTLMPFDNTIVTVSMTG
AEIKKVLEQAVQDGGKGIQVAGLSFKYDPNKPSMNRVFDIKKSDGTPIDMNAKYLVATNN
FMGTGGDGFTEFTDPDVQKSYIDTQKLVRDAFIDAVKAQGHITAKIDNRISPATMPASNE
TTITVLATSDVHGNLVPWDYSSAKEANQGLSKVAGYVDQVRSENPNVVLVDNGDTIQGTP
LSYYYDKIDTKSEYPMAKAMGAMHYDTWTLGNHEFNYGLDVLNRVIADMEKENIHVLSAN
TYKDDGTNFVEPYYIKTITTPMGDVKVGILGLTTKEIPSWEDKSHYAGLKFNDLVEEANK
WVPKVRAAGADIVVVAMHSGEESPSDTIPENQVKAVAQGVNGIDAIIAGHTHAVIQMDTF
KNPEGKDVIVTEPGKWGQYVSRIDFNLTKDENGKWTIDSKTSKAVAMDSSIKPDENIMQL
AEPYQEATLKYVGTKIGTASGDFLGKDQLTKETALMDLINKVQKYYAKTDLSIAAPLSST
AQILKGDVTIQDMMSVYVFENYLYGIKMTGKQLKDWMEWSVRYYQQVKSPDDPITKDKTL
NIPDYNLDQLYGASYTIDLTQPVGNRIKNLTVNGKPVKDDDVFTVAINNYRFNGGGGFMK
AAGITNPVIVFDSAKAYGDDGQVRNLMISYIKMKGTIDPVVDNYWTISKTPVSEGNVGSK
GIVTASALNVRLGAGINYKVIGVLRAGQSINIVGENNGWYQIDYNGKTGYVYGKYVASSP
DLSNVAVLKSVRVTAKDGLNVRVNNSINALKIGAVPYGYELKVVGEYDGWYKVQYNGAYG
FVYAKHTK
Download sequence
Identical sequences D9TS90
gi|304317752|ref|YP_003852897.1| WP_013298770.1.54986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]