SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18310932|ref|NP_562866.1| from Clostridium perfringens str. 13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18310932|ref|NP_562866.1|
Domain Number 1 Region: 635-926
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.42e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 52-345
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.31e-69
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00028
Further Details:      
 
Domain Number 3 Region: 924-1098
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.27e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00012
Further Details:      
 
Domain Number 4 Region: 375-586
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.88e-28
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18310932|ref|NP_562866.1|
Sequence length 1181
Comment 2', 3'-cyclic nucleotide 2'-phosphodiesterase [Clostridium perfringens str. 13]
Sequence
MLKKVRDKKFTALAVATSMIFGIATPLTTVKATENLAPENLEKKGEEASLEKEGDVTIQI
LGTSDLHGRFMNYEYARNQKSDGGLNQISTLVNEARNENPNTIVVDNGDTIQGNFNHLFK
NCPNPMVMGMNAIGYDVFSLGNHEFNYGMDNLNDVVSQANDNLDVLCANLYKDGKRVYEG
YTTREIEGVEVALIGVVSPHIMKWDSENLKGYEAKNPAEEVGFVIDEIENRPEGGADVYA
VVSHVGLESEYGNGDSARAIAEMNPEVSAIVAGHSHTNVPEEKINNAVISQPTSNGQMVS
KIELTVRKNGEKVEVVDKKSKLLSTKGVAEDQKINDLLADFHNTAIADATAPVGEMVGGN
LADKNEIKEIPQSLVEDQGITDFINEVQLYNSRKHLESKNINPDEVYMVSGAALFSASSN
LYEGNISKADISNIYRYDNKLYTIKTNGKQLKKYMEKNGEYYNAYKDGDLTVSFNEDVRM
YLYDMFDGISYEINISKEPGQRIENLKFEKDGKPVEDSDVVYLTVNDYRYNSGLAAGIMD
QGEHEKIYDTNNDQISDMRDLIVDYIQNVKGGKITKNVDNNWKITGNDWDSEQRELAVKL
INEGKIKIPVSEDGRTPNVKAVTWNDVLEALGTKEVEIPIVTFNDFHGSLAESKSDVGAA
KLVGEIKRVKEENPNTVVVTGGDIYQGSAMSNLLKGEPVTAMLKEMGLEFSAVGNHEFDW
GYEYIPDWAKAGEFDFLASNIYEKETGEPVEWAKPYGVVEREGKKVGFIGLATPETAYKT
KPDNVAHLEFKDPVEATKTWVDYLENEENVDAVVVLSHLGSEQNRETGEITGEIVEVAEV
PGVDAIISAHSHQKVEGKVNGVPVIQAYKNGRNLGFVNLKFDYNDELVVTTKLDDISKRK
DTLPVDKNMEDILAKFEADLAPIMNEKVADLSVDLPHDRDTGVSPMGATVAETMRRIVDA
DIAITNGGGVRAPLMAGTVTVGDMYTILPFDNTLVTMEMKGSDIIKVLEHGIEPDNFGWG
QHAGVKFWYTPGAERGEKITSVRLADGTKLENDKYYTVVTNDFMAVGGDSYDFSAAKNVV
DTNLVIRDEMANYWRENGIDPITDLATLLEAGEDTTVDLEKPEKPENPGNPETPQNPENP
DNGENLPNTGMPFGTGAVAAMGTVLTIGGLAVLRKKKNNVA
Download sequence
Identical sequences Q8XJ11
195102.CPE1950 WP_011010702.1.32463 gi|18310932|ref|NP_562866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]