SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297562559|ref|YP_003681533.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562559|ref|YP_003681533.1|
Domain Number 1 Region: 138-338
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.31e-21
Family Eukaryotic proteases 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297562559|ref|YP_003681533.1|
Sequence length 351
Comment hypothetical protein Ndas_3627 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTSSTAHRILAPLAAAAVAAGGLFLAEQLPAPASAVTQAIHSPAVPAQEDREALSHVAGL
SHQSAAVTGDQHQAVLDYWTEERMAAAKPITGMLEDVLPPAEDGSAPDGGVEHQAAPRPD
SRGERWTSGGLVTRTTGKVYLTMDGRDFTCSASVVDAANRSTVVTAGHCAKDGRGSWARN
WTFVPGHADGESPYGRFTASDLLVAPEWSRQADDSYDFAMVVLNPDGGTTVQERVGSQRI
EFGTWTEDKVREGVQVYTFGYPSAAPYEGRHLHYCSGRTEPDTGGTTANGVRCSMTQGSS
GGPWFAGFDTGTGRGTITSVVSFKYADDRSVQYGPRLGQEARELYEQAAQL
Download sequence
Identical sequences D7B506
WP_013154634.1.70090 WP_013154634.1.87825 gi|297562559|ref|YP_003681533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]