SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297564112|ref|YP_003683085.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564112|ref|YP_003683085.1|
Domain Number 1 Region: 340-537
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-56
Family Prokaryotic proteases 0.0000044
Further Details:      
 
Domain Number 2 Region: 513-613
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family HtrA-like serine proteases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297564112|ref|YP_003683085.1|
Sequence length 640
Comment peptidase S1 and S6 chymotrypsin/Hap [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MNPNEPSAGTEPGAAAGSGLPEHRPAEPADQAGPSGPHEGGSSTGDGTDVRGASGGEHGG
VPAGQDDLTHGAEHAGPQRSFGGSESQGAGGESGAGEPGERVERPAQHEPGGYTGVWQSG
EQPGGHPGAERSGGYAAAGQTGEGFPSQQGGHPGAERHGWPETGPAGTGPTFSPPGQPPR
WATGPNDPEHASYTFPPPGGGYGAAAGGQHEQFSAHHPAPPHGGQNGPHGPVGHGQPPYG
DGGAFGAGGPGGPGDHGGHGGQPPFGGAFPGSVPPQGSGGKRGSGRIVTVAAITALVTSL
IVGPMTALGTAYLFPNGLSGPISSLNQEQESTQTEGEVGEVADTVLPSVVSIRTANGGGS
GVVISSDGQILTNAHVVAAAEGGPIEVLFNDGSSARAEVLGSDPVSDIAVIQAEGRNDLT
PAALGDSEQVGVGAEVVAIGSPLGLSGTVTTGVVSALNRPVNTGQSGQTSTVINAIQTDA
AINPGNSGGPLVNMNGEVIGINTAIAGVSQDSGSVGLGFAIPINQVRPIAEQLVEDGSAS
YPAIEATITNSRVGGAEIVEVTEGGAAAEAGLQAGDVVVSVDGEQVSTPDELIAQIRIRQ
PGEEVTLGVVPDGGSGSEEEVTVTLGEQSVEAAQNEEGGN
Download sequence
Identical sequences D7B8S1
WP_013156186.1.70090 gi|297564112|ref|YP_003683085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]