SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1d7aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d7aA
Domain Number 1 Region: 3-156
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.76e-99
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d7aA   PDB: 1d7a   SUPERFAMILY: 1d7aA
Sequence length 161
Comment (A:)
Sequence
garvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
anaallaaqilathdkelhqrlndwrkaqtdevlenpdprg
Download sequence
Identical sequences 1d7a_A 1d7a_B 1d7a_C 1d7a_D 1d7a_L 1d7a_M 1d7a_N 1d7a_O 000105044|e1d7aM1|2007.1.9.1|M:1-161 000105045|e1d7aA1|2007.1.9.1|A:1-161 000105047|e1d7aB1|2007.1.9.1|B:1-161 000105056|e1d7aO1|2007.1.9.1|O:1-161 000105057|e1d7aD1|2007.1.9.1|D:1-161 000105058|e1d7aC1|2007.1.9.1|C:1-161 000105059|e1d7aL1|2007.1.9.1|L:1-161 000105064|e1d7aN1|2007.1.9.1|N:1-161 d1d7aa_ d1d7ab_ d1d7ac_ d1d7ad_ d1d7al_ d1d7am_ d1d7an_ d1d7ao_ 1d7aA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]