SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1di6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1di6A
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.83e-78
Family MogA-like 0.000000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1di6A   PDB: 1di6   SUPERFAMILY: 1di6A
Sequence length 195
Comment (A:)
Sequence
matlriglvsisdrassgvyqdkgipaleewltsalttpfeletrlipdeqaiieqtlce
lvdemschlvlttggtgparrdvtpdatlavadrempgfgeqmrqislhfvptailsrqv
gvirkqalilnlpgqpksiketlegvkdaegnvvvhgifasvpyciqllegpyvetapev
vaafrpksarrdvse
Download sequence
Identical sequences cath|current|1di6A00/2-191 cath|current|1di7A00/2-191 1di6_A 1di7_A 1di6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]